Dahschur IV: Tempelanlagen im Tal der Knickpyramide
Gespeichert in:
| Beteilige Person: | |
|---|---|
| Weitere beteiligte Personen: | |
| Format: | Buch |
| Sprache: | Deutsch |
| Veröffentlicht: |
Wiesbaden
Harrassowitz Verlag
[2021]
|
| Schriftenreihe: | Archäologische Veröffentlichungen des Deutschen Archäologischen Instituts
133 |
| Schlagwörter: | |
| Links: | http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=032804294&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |
| Umfang: | 186 Seiten, 34 Tafeln Illustrationen, Karten, Pläne 6 Faltpläne |
| ISBN: | 9783447113458 |
Internformat
MARC
| LEADER | 00000nam a2200000 cb4500 | ||
|---|---|---|---|
| 001 | BV047403263 | ||
| 003 | DE-604 | ||
| 005 | 20211102 | ||
| 007 | t| | ||
| 008 | 210805s2021 gw a||| |||| 00||| ger d | ||
| 015 | |a 21,N31 |2 dnb | ||
| 016 | 7 | |a 123783466X |2 DE-101 | |
| 020 | |a 9783447113458 |c hardback |9 978-3-447-11345-8 | ||
| 035 | |a (OCoLC)1263261411 | ||
| 035 | |a (DE-599)DNB123783466X | ||
| 040 | |a DE-604 |b ger |e rda | ||
| 041 | 0 | |a ger | |
| 044 | |a gw |c XA-DE-HE | ||
| 049 | |a DE-20 |a DE-188 |a DE-12 |a DE-19 |a DE-11 | ||
| 084 | |a ALT |q DE-12 |2 fid | ||
| 084 | |a LE 5242 |0 (DE-625)91003: |2 rvk | ||
| 084 | |a LE 5244 |0 (DE-625)91004: |2 rvk | ||
| 084 | |8 1\p |a 930 |2 23sdnb | ||
| 100 | 1 | |a Arnold, Felix |d 1972- |e Verfasser |0 (DE-588)1044643692 |4 aut | |
| 245 | 1 | 0 | |a Dahschur IV |b Tempelanlagen im Tal der Knickpyramide |c von Felix Arnold ; mit Beiträgen von Ashraf Senussi |
| 264 | 1 | |a Wiesbaden |b Harrassowitz Verlag |c [2021] | |
| 264 | 4 | |c © 2021 | |
| 300 | |a 186 Seiten, 34 Tafeln |b Illustrationen, Karten, Pläne |e 6 Faltpläne | ||
| 336 | |b txt |2 rdacontent | ||
| 337 | |b n |2 rdamedia | ||
| 338 | |b nc |2 rdacarrier | ||
| 490 | 1 | |a Archäologische Veröffentlichungen des Deutschen Archäologischen Instituts |v 133 | |
| 650 | 0 | 7 | |a Tempel |0 (DE-588)4059416-6 |2 gnd |9 rswk-swf |
| 650 | 0 | 7 | |a Funde |0 (DE-588)4071507-3 |2 gnd |9 rswk-swf |
| 650 | 0 | 7 | |a Ausgrabung |0 (DE-588)4129464-6 |2 gnd |9 rswk-swf |
| 651 | 7 | |a Knickpyramide |g Dahschur |0 (DE-588)1114095915 |2 gnd |9 rswk-swf | |
| 651 | 7 | |a Dahschur |0 (DE-588)4138003-4 |2 gnd |9 rswk-swf | |
| 653 | |a Architektur‐ und Baugeschichte | ||
| 653 | |a Ägyptologie | ||
| 653 | |a Geschichte der Landschaftsarchitektur | ||
| 688 | 7 | |a Ägypten, Zeit der Pharaonen |0 (DE-2581)TH000003385 |2 gbd | |
| 688 | 7 | |a Landschaft |0 (DE-2581)TH000006132 |2 gbd | |
| 688 | 7 | |a Pyramiden |0 (DE-2581)TH000008093 |2 gbd | |
| 689 | 0 | 0 | |a Dahschur |0 (DE-588)4138003-4 |D g |
| 689 | 0 | 1 | |a Tempel |0 (DE-588)4059416-6 |D s |
| 689 | 0 | 2 | |a Ausgrabung |0 (DE-588)4129464-6 |D s |
| 689 | 0 | |5 DE-604 | |
| 689 | 1 | 0 | |a Knickpyramide |g Dahschur |0 (DE-588)1114095915 |D g |
| 689 | 1 | 1 | |a Tempel |0 (DE-588)4059416-6 |D s |
| 689 | 1 | 2 | |a Ausgrabung |0 (DE-588)4129464-6 |D s |
| 689 | 1 | 3 | |a Funde |0 (DE-588)4071507-3 |D s |
| 689 | 1 | |5 DE-604 | |
| 700 | 1 | |a Senussi, Ashraf |0 (DE-588)1068226862 |4 ctb | |
| 710 | 2 | |a Otto Harrassowitz GmbH & Co. KG |0 (DE-588)1068107626 |4 pbl | |
| 830 | 0 | |a Archäologische Veröffentlichungen des Deutschen Archäologischen Instituts |v 133 |w (DE-604)BV000897233 |9 133 | |
| 856 | 4 | 2 | |m Digitalisierung BSB München - ADAM Catalogue Enrichment |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=032804294&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |3 Inhaltsverzeichnis |
| 940 | 1 | |n gbd | |
| 940 | 1 | |q gbd_4_2108 | |
| 940 | 1 | |q BSB_NED_20210916 | |
| 883 | 1 | |8 1\p |a vlb |d 20210729 |q DE-101 |u https://d-nb.info/provenance/plan#vlb | |
| 942 | 1 | 1 | |c 930.1 |e 22/bsb |f 09013 |g 32 |
| 943 | 1 | |a oai:aleph.bib-bvb.de:BVB01-032804294 | |
Datensatz im Suchindex
| _version_ | 1819281503049220096 |
|---|---|
| adam_text | Inhaltsverzeichnis VORWORT................................................................. 7 ABKÜRZUNGSVERZEICHNIS .............................. 9 LITERATURVERZEICHNIS..................................... 11 1. DER KULTBEZIRK IM NORDEN...................... 1.1 Befund.......................................................... 1.1.1 Bauplatz............................................. 1.1.2 Einfassung......................................... 1.1.3 Garten................................................ 1.1.4 Ziegelbau........................................... 1.1.5 Jüngere Einbauten............................ 1.1.6 Nördliche Fläche .............................. 1.1.7 Norderweiterung des Gartens........... 1.2 Konstruktion und Rekonstruktion............. 1.2.1 Mauerwerk......................................... 1.2.2 Wand und Bodenbeläge................... 1.2.3 Türen.................................................. 1.2.4 Säulen ................................................ 1.2.5 Decken................................................ 1.3 Funde............................................................ 1.3.1 Keramik (Ashraf Senussi) ............. 1.3.2 Kleinfunde......................................... 1.4 Interpretation............................................... 1.4.1 Datierung........................................... 1.4.2 Nutzungsdauer................................... 1.4.3 Rituelle Nutzung.............................. 1.4.4 Baugeschichtliche Einordnung........ 1.4.5 Bedeutung......................................... 2. STEINTEMPEL
....................................................... 2.1 Baubefund .................................................... 2.1.1 Das Tempelhaus................................ 2.1.2 Umfassungsmauer ............................ 2.2 Baukonstruktion........................................... 2.2.1 Mauerwerk......................................... 2.2.2 Transportvermerke............................ 2.3 Funde............................................................ 2.3.1 Keramik (Ashraf Senussi) ............. 2.3.2 Kleinfunde......................................... 2.4 Interpretation............................................... 2.4.1 Der Tempel im Rahmen der Bautätigkeit des Königs ................... 2.4.2 Baugeschichtliche Stellung............... 2.4.3 Funktion und Bedeutung................. 19 19 19 20 26 29 33 34 35 35 36 36 36 36 37 37 37 44 46 46 49 50 51 55 57 57 57 70 72 72 73 79 79 80 80 80 82 83 3. DIE AUFWEGE .................................................... 3.1 Baubefund .................................................... 3.1.1 Der obere Aufweg ............................ 3.1.2 Der untere Aufweg............................ 3.2 Keramik (Ashraf Senussi).......................... 3.2.1 Phase 4................................................ 3.2.2 Phase 5................................................ 3.2.3 Phase 6................................................ 3.2.4 Phase 7................................................ 3.2.5 Phase 8................................................ 3.2.6 Phase 9................................................ 3.2.7
Phase10.............................................. 3.3 Interpretation............................................... 3.3.1 Datierung........................................... 3.3.2 Einordnung in die baugeschichtliche Entwicklung....................................... 3.3.3 Nutzung und Bedeutung................. 87 87 87 93 107 107 107 112 117 121 124 125 126 126 4. SIEDLUNGEN...................................................... 4.1 Befund.......................................................... 4.1.1 Siedlung nördlich des Tempel bezirkes ............................................. 4.1.2 Bauten östlich des Tempelbezirkes . . 4.1.3 Bauten südlich des Tempel bezirkes ............................................. 4.1.4 Bauten innerhalb des Tempel bezirkes ............................................. 4.1.5 Nutzung und Nachnutzung des Steintempels....................................... 4.2 Keramik (Ashraf Senussi).......................... 4.2.1 Houses south of the temple enclosure ........................................... 4.3 Kleinfunde.................................................... 4.3.1 Rollsiegel aus Holz............................ 4.3.2 Kalksteinfigur..................................... 4.3.3 Perlen................................................. 4.3.4 Metallobjekte..................................... 4.4 Interpretation............................................... 4.4.1 Datierung........................................... 4.4.2 Siedlungstyp....................................... 4.4.3 Einordnung in die baugeschichtliche
Entwicklung....................................... 4.4.4 Bewohner........................................... 4.4.5 Kultbetrieb......................................... 131 131 126 127 131 131 131 137 140 144 144 169 169 170 171 171 171 171 174 174 178 179
ZUSAMMENFASSUNG DER ERGEBNISSE . . . . 5-і Phase I. Der ältere Kultbezirk....................... 5.2 Phase II. Der Steintempel.............................. 5-3 Phase III. Der Hafen und die Aufwege . . . . 5-4 Phase IV. Die Siedlungen im Norden und Süden ................................................................ Phase V. Kultbetrieb im späteren Alten 5-5 Reich ................................................................ 5.6 Phase VI. Kultbetrieb im Mittleren Reich . . . 6 181 181 181 181 ABBILDUNGSVERZEICHNIS.................................... 183 TAFELVERZEICHNIS .................................................. 185 BEILAGENVERZEICHNIS ......................................... 187 BILDNACHWEISE......................................................... 189 TAFELN........................................................................... 191 181 181 182
|
| any_adam_object | 1 |
| author | Arnold, Felix 1972- |
| author2 | Senussi, Ashraf |
| author2_role | ctb |
| author2_variant | a s as |
| author_GND | (DE-588)1044643692 (DE-588)1068226862 |
| author_facet | Arnold, Felix 1972- Senussi, Ashraf |
| author_role | aut |
| author_sort | Arnold, Felix 1972- |
| author_variant | f a fa |
| building | Verbundindex |
| bvnumber | BV047403263 |
| classification_rvk | LE 5242 LE 5244 |
| ctrlnum | (OCoLC)1263261411 (DE-599)DNB123783466X |
| discipline | Klassische Archäologie |
| format | Book |
| fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>02995nam a2200709 cb4500</leader><controlfield tag="001">BV047403263</controlfield><controlfield tag="003">DE-604</controlfield><controlfield tag="005">20211102 </controlfield><controlfield tag="007">t|</controlfield><controlfield tag="008">210805s2021 gw a||| |||| 00||| ger d</controlfield><datafield tag="015" ind1=" " ind2=" "><subfield code="a">21,N31</subfield><subfield code="2">dnb</subfield></datafield><datafield tag="016" ind1="7" ind2=" "><subfield code="a">123783466X</subfield><subfield code="2">DE-101</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9783447113458</subfield><subfield code="c">hardback</subfield><subfield code="9">978-3-447-11345-8</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)1263261411</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-599)DNB123783466X</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-604</subfield><subfield code="b">ger</subfield><subfield code="e">rda</subfield></datafield><datafield tag="041" ind1="0" ind2=" "><subfield code="a">ger</subfield></datafield><datafield tag="044" ind1=" " ind2=" "><subfield code="a">gw</subfield><subfield code="c">XA-DE-HE</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-20</subfield><subfield code="a">DE-188</subfield><subfield code="a">DE-12</subfield><subfield code="a">DE-19</subfield><subfield code="a">DE-11</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">ALT</subfield><subfield code="q">DE-12</subfield><subfield code="2">fid</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">LE 5242</subfield><subfield code="0">(DE-625)91003:</subfield><subfield code="2">rvk</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">LE 5244</subfield><subfield code="0">(DE-625)91004:</subfield><subfield code="2">rvk</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="8">1\p</subfield><subfield code="a">930</subfield><subfield code="2">23sdnb</subfield></datafield><datafield tag="100" ind1="1" ind2=" "><subfield code="a">Arnold, Felix</subfield><subfield code="d">1972-</subfield><subfield code="e">Verfasser</subfield><subfield code="0">(DE-588)1044643692</subfield><subfield code="4">aut</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Dahschur IV</subfield><subfield code="b">Tempelanlagen im Tal der Knickpyramide</subfield><subfield code="c">von Felix Arnold ; mit Beiträgen von Ashraf Senussi</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">Wiesbaden</subfield><subfield code="b">Harrassowitz Verlag</subfield><subfield code="c">[2021]</subfield></datafield><datafield tag="264" ind1=" " ind2="4"><subfield code="c">© 2021</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">186 Seiten, 34 Tafeln</subfield><subfield code="b">Illustrationen, Karten, Pläne</subfield><subfield code="e">6 Faltpläne</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="b">n</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="b">nc</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="490" ind1="1" ind2=" "><subfield code="a">Archäologische Veröffentlichungen des Deutschen Archäologischen Instituts</subfield><subfield code="v">133</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Tempel</subfield><subfield code="0">(DE-588)4059416-6</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Funde</subfield><subfield code="0">(DE-588)4071507-3</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Ausgrabung</subfield><subfield code="0">(DE-588)4129464-6</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="651" ind1=" " ind2="7"><subfield code="a">Knickpyramide</subfield><subfield code="g">Dahschur</subfield><subfield code="0">(DE-588)1114095915</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="651" ind1=" " ind2="7"><subfield code="a">Dahschur</subfield><subfield code="0">(DE-588)4138003-4</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="653" ind1=" " ind2=" "><subfield code="a">Architektur‐ und Baugeschichte</subfield></datafield><datafield tag="653" ind1=" " ind2=" "><subfield code="a">Ägyptologie</subfield></datafield><datafield tag="653" ind1=" " ind2=" "><subfield code="a">Geschichte der Landschaftsarchitektur</subfield></datafield><datafield tag="688" ind1=" " ind2="7"><subfield code="a">Ägypten, Zeit der Pharaonen</subfield><subfield code="0">(DE-2581)TH000003385</subfield><subfield code="2">gbd</subfield></datafield><datafield tag="688" ind1=" " ind2="7"><subfield code="a">Landschaft</subfield><subfield code="0">(DE-2581)TH000006132</subfield><subfield code="2">gbd</subfield></datafield><datafield tag="688" ind1=" " ind2="7"><subfield code="a">Pyramiden</subfield><subfield code="0">(DE-2581)TH000008093</subfield><subfield code="2">gbd</subfield></datafield><datafield tag="689" ind1="0" ind2="0"><subfield code="a">Dahschur</subfield><subfield code="0">(DE-588)4138003-4</subfield><subfield code="D">g</subfield></datafield><datafield tag="689" ind1="0" ind2="1"><subfield code="a">Tempel</subfield><subfield code="0">(DE-588)4059416-6</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="2"><subfield code="a">Ausgrabung</subfield><subfield code="0">(DE-588)4129464-6</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2=" "><subfield code="5">DE-604</subfield></datafield><datafield tag="689" ind1="1" ind2="0"><subfield code="a">Knickpyramide</subfield><subfield code="g">Dahschur</subfield><subfield code="0">(DE-588)1114095915</subfield><subfield code="D">g</subfield></datafield><datafield tag="689" ind1="1" ind2="1"><subfield code="a">Tempel</subfield><subfield code="0">(DE-588)4059416-6</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="1" ind2="2"><subfield code="a">Ausgrabung</subfield><subfield code="0">(DE-588)4129464-6</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="1" ind2="3"><subfield code="a">Funde</subfield><subfield code="0">(DE-588)4071507-3</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="1" ind2=" "><subfield code="5">DE-604</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Senussi, Ashraf</subfield><subfield code="0">(DE-588)1068226862</subfield><subfield code="4">ctb</subfield></datafield><datafield tag="710" ind1="2" ind2=" "><subfield code="a">Otto Harrassowitz GmbH & Co. KG</subfield><subfield code="0">(DE-588)1068107626</subfield><subfield code="4">pbl</subfield></datafield><datafield tag="830" ind1=" " ind2="0"><subfield code="a">Archäologische Veröffentlichungen des Deutschen Archäologischen Instituts</subfield><subfield code="v">133</subfield><subfield code="w">(DE-604)BV000897233</subfield><subfield code="9">133</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">Digitalisierung BSB München - ADAM Catalogue Enrichment</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=032804294&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Inhaltsverzeichnis</subfield></datafield><datafield tag="940" ind1="1" ind2=" "><subfield code="n">gbd</subfield></datafield><datafield tag="940" ind1="1" ind2=" "><subfield code="q">gbd_4_2108</subfield></datafield><datafield tag="940" ind1="1" ind2=" "><subfield code="q">BSB_NED_20210916</subfield></datafield><datafield tag="883" ind1="1" ind2=" "><subfield code="8">1\p</subfield><subfield code="a">vlb</subfield><subfield code="d">20210729</subfield><subfield code="q">DE-101</subfield><subfield code="u">https://d-nb.info/provenance/plan#vlb</subfield></datafield><datafield tag="942" ind1="1" ind2="1"><subfield code="c">930.1</subfield><subfield code="e">22/bsb</subfield><subfield code="f">09013</subfield><subfield code="g">32</subfield></datafield><datafield tag="943" ind1="1" ind2=" "><subfield code="a">oai:aleph.bib-bvb.de:BVB01-032804294</subfield></datafield></record></collection> |
| geographic | Knickpyramide Dahschur (DE-588)1114095915 gnd Dahschur (DE-588)4138003-4 gnd |
| geographic_facet | Knickpyramide Dahschur Dahschur |
| id | DE-604.BV047403263 |
| illustrated | Illustrated |
| indexdate | 2024-12-20T19:18:33Z |
| institution | BVB |
| institution_GND | (DE-588)1068107626 |
| isbn | 9783447113458 |
| language | German |
| oai_aleph_id | oai:aleph.bib-bvb.de:BVB01-032804294 |
| oclc_num | 1263261411 |
| open_access_boolean | |
| owner | DE-20 DE-188 DE-12 DE-19 DE-BY-UBM DE-11 |
| owner_facet | DE-20 DE-188 DE-12 DE-19 DE-BY-UBM DE-11 |
| physical | 186 Seiten, 34 Tafeln Illustrationen, Karten, Pläne 6 Faltpläne |
| psigel | gbd_4_2108 BSB_NED_20210916 |
| publishDate | 2021 |
| publishDateSearch | 2021 |
| publishDateSort | 2021 |
| publisher | Harrassowitz Verlag |
| record_format | marc |
| series | Archäologische Veröffentlichungen des Deutschen Archäologischen Instituts |
| series2 | Archäologische Veröffentlichungen des Deutschen Archäologischen Instituts |
| spellingShingle | Arnold, Felix 1972- Dahschur IV Tempelanlagen im Tal der Knickpyramide Archäologische Veröffentlichungen des Deutschen Archäologischen Instituts Tempel (DE-588)4059416-6 gnd Funde (DE-588)4071507-3 gnd Ausgrabung (DE-588)4129464-6 gnd |
| subject_GND | (DE-588)4059416-6 (DE-588)4071507-3 (DE-588)4129464-6 (DE-588)1114095915 (DE-588)4138003-4 |
| title | Dahschur IV Tempelanlagen im Tal der Knickpyramide |
| title_auth | Dahschur IV Tempelanlagen im Tal der Knickpyramide |
| title_exact_search | Dahschur IV Tempelanlagen im Tal der Knickpyramide |
| title_full | Dahschur IV Tempelanlagen im Tal der Knickpyramide von Felix Arnold ; mit Beiträgen von Ashraf Senussi |
| title_fullStr | Dahschur IV Tempelanlagen im Tal der Knickpyramide von Felix Arnold ; mit Beiträgen von Ashraf Senussi |
| title_full_unstemmed | Dahschur IV Tempelanlagen im Tal der Knickpyramide von Felix Arnold ; mit Beiträgen von Ashraf Senussi |
| title_short | Dahschur IV |
| title_sort | dahschur iv tempelanlagen im tal der knickpyramide |
| title_sub | Tempelanlagen im Tal der Knickpyramide |
| topic | Tempel (DE-588)4059416-6 gnd Funde (DE-588)4071507-3 gnd Ausgrabung (DE-588)4129464-6 gnd |
| topic_facet | Tempel Funde Ausgrabung Knickpyramide Dahschur Dahschur |
| url | http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=032804294&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |
| volume_link | (DE-604)BV000897233 |
| work_keys_str_mv | AT arnoldfelix dahschurivtempelanlagenimtalderknickpyramide AT senussiashraf dahschurivtempelanlagenimtalderknickpyramide AT ottoharrassowitzgmbhcokg dahschurivtempelanlagenimtalderknickpyramide |