Parlament s lidskou tváří: biografické aspekty české legislativní politiky
Gespeichert in:
Internformat
MARC
| LEADER | 00000nam a2200000 cb4500 | ||
|---|---|---|---|
| 001 | BV046627063 | ||
| 003 | DE-604 | ||
| 005 | 20200617 | ||
| 007 | t| | ||
| 008 | 200312s2019 xx |||| |||| 00||| cze d | ||
| 020 | |a 9788073254919 |9 978-80-7325-491-9 | ||
| 020 | |a 9788021095045 |9 978-80-210-9504-5 | ||
| 035 | |a (OCoLC)1145196006 | ||
| 035 | |a (DE-599)BVBBV046627063 | ||
| 040 | |a DE-604 |b ger |e rda | ||
| 041 | 0 | |a cze | |
| 049 | |a DE-12 | ||
| 084 | |a OST |q DE-12 |2 fid | ||
| 100 | 1 | |a Balík, Stanislav |d 1956- |e Verfasser |0 (DE-588)143712969 |4 aut | |
| 245 | 1 | 0 | |a Parlament s lidskou tváří |b biografické aspekty české legislativní politiky |c Stanislav Balík, Michal Pink, Petr Voda |
| 250 | |a 1. vydání | ||
| 264 | 1 | |a Brno |b Centrum pro studium demokracie a kultury |c 2019 | |
| 264 | 1 | |a Brno |b Masarykova univerzita | |
| 300 | |a 162 Seiten |b Diagramme |c 21 cm | ||
| 336 | |b txt |2 rdacontent | ||
| 337 | |b n |2 rdamedia | ||
| 338 | |b nc |2 rdacarrier | ||
| 490 | 1 | |a Politologická řada |v svazek č. 77 | |
| 500 | |a Enthält 59 Tabellen | ||
| 546 | |a Zusammenfassung in englischer Sprache | ||
| 648 | 7 | |a Geschichte 1920-2109 |2 gnd |9 rswk-swf | |
| 650 | 0 | 7 | |a Abgeordneter |0 (DE-588)4000135-0 |2 gnd |9 rswk-swf |
| 650 | 0 | 7 | |a Parlament |0 (DE-588)4044685-2 |2 gnd |9 rswk-swf |
| 650 | 0 | 7 | |a Politik |0 (DE-588)4046514-7 |2 gnd |9 rswk-swf |
| 651 | 7 | |a Tschechoslowakei |0 (DE-588)4078435-6 |2 gnd |9 rswk-swf | |
| 651 | 7 | |a Tschechien |0 (DE-588)4303381-7 |2 gnd |9 rswk-swf | |
| 689 | 0 | 0 | |a Tschechoslowakei |0 (DE-588)4078435-6 |D g |
| 689 | 0 | 1 | |a Tschechien |0 (DE-588)4303381-7 |D g |
| 689 | 0 | 2 | |a Politik |0 (DE-588)4046514-7 |D s |
| 689 | 0 | 3 | |a Parlament |0 (DE-588)4044685-2 |D s |
| 689 | 0 | 4 | |a Abgeordneter |0 (DE-588)4000135-0 |D s |
| 689 | 0 | 5 | |a Geschichte 1920-2109 |A z |
| 689 | 0 | |5 DE-604 | |
| 700 | 1 | |a Pink, Michal |d 1976- |e Verfasser |0 (DE-588)1036806006 |4 aut | |
| 700 | 1 | |a Voda, Petr |e Verfasser |0 (DE-588)1206378395 |4 aut | |
| 830 | 0 | |a Politologická řada |v svazek č. 77 |w (DE-604)BV013246254 |9 77 | |
| 856 | 4 | 2 | |m Digitalisierung BSB München 25 - ADAM Catalogue Enrichment |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=032038675&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |3 Inhaltsverzeichnis |
| 856 | 4 | 2 | |m Digitalisierung BSB München 25 - ADAM Catalogue Enrichment |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=032038675&sequence=000003&line_number=0002&func_code=DB_RECORDS&service_type=MEDIA |3 Register // Personenregister |
| 856 | 4 | 2 | |m Digitalisierung BSB München 25 - ADAM Catalogue Enrichment |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=032038675&sequence=000005&line_number=0003&func_code=DB_RECORDS&service_type=MEDIA |3 Literaturverzeichnis |
| 856 | 4 | 2 | |m Digitalisierung BSB München 25 - ADAM Catalogue Enrichment |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=032038675&sequence=000007&line_number=0004&func_code=DB_RECORDS&service_type=MEDIA |3 Abstract |
| 940 | 1 | |n oe | |
| 940 | 1 | |q BSB_NED_20200617 | |
| 942 | 1 | 1 | |c 909 |e 22/bsb |f 0904 |g 4371 |
| 942 | 1 | 1 | |c 909 |e 22/bsb |f 090511 |g 4371 |
| 942 | 1 | 1 | |c 909 |e 22/bsb |f 090512 |g 4371 |
| 943 | 1 | |a oai:aleph.bib-bvb.de:BVB01-032038675 | |
Datensatz im Suchindex
| _version_ | 1819253747633618944 |
|---|---|
| adam_text | 160 I Parlament s lidskou tváří OBSAH ÚVOD....................................................................................................... 5 Stávající stav poznání........................................................................ 6 Kapitola 1: PRVOREPUBLIKOVÍ POSLANCI.......................................................11 Výzkumné otázky a cíle...................................................................ll Metodologie a data............................................................................14 Analytická mřížka............................................................................16 Volby a stranický systém 1920-1935 ................................................21 Volební systém.................................................................................. 21 Parlamentní volby 1920-1935.........................................................22 Mechanické charakteristiky stranického systému......................... 28 Analýza deskriptivni reprezentace prvorepublikové Poslanecké sněmovny.........................................................................31 Personální obměna.........................................................................31 Předchozí politická zkušenost.........................................................36 Vek................................................................................................. 41 Zastoupení žen.............................................................................. 46 Vzdělání...........................................................................................
50 Bydliště........................................................................................... 55 Teritoriální rozložení........................................................................60 Profese........................................................................................... 65 Shrnutí...............................................................................................71
Obsah I 161 Kapitola 2: KDO JSOU ČEŠTÍ POSLANCI OD ROKU 1990 ...................................... 73 Volby a stranický systém 1990-2017 ............................................. 75 První volby do České národní rady a Federálního shromáždění 1990 a 1992......................................... 77 Volby do Poslanecké sněmovny PČR............................................... 78 Poslanci České národní rady a Federálního shromáždění v letech 1990 a 1992 ........................................................................ 80 Poslanecká sněmovna a její složení v letech 1996—2017................ 89 Česká strana sociálně demokratická............................................... 89 Křesťanská a demokratická unie - Československá strana lidová. . 92 Komunistická strana Čech a Moravy................................................95 Občanská demokratická strana...................................................... 97 Menší středopravicové strany...................................................... 100 Krajně pravicové a populistické strany.......................................... 103 ANO 2011 a Piráti - nové strany po roce 2013................................. 106 Shrnutí............................................................................................ 109 Kapitola 3: VLIV BIOGRAFIÍ POSLANCŮ NA JEJICH AKTIVITU V POSLANECKÉ SNĚMOVNĚ........................................................ lil Úvod.................................................................................................111 Teoretické
předpoklady.................................................................... ИЗ Jak měřit obsah a snahu v poslanecké práci................................. 114 Metody analýzy............................................................................. 119 Výsledky analýzy - aktivita poslanců........................................... 119 Výsledky analýzy - tematické zaměření poslanecké práce . . . 126 Shrnutí............................................................................................. 133
162 I Parlament s lidskou tváří ZÁVĚR.........................................................................................................136 PŘÍLOHY.................................................................................. 140 SUMMARY............................................................................... 146 SEZNAM POUŽITÉ LITERATURY A ZDROJŮ................................. 148 Literatura............................................................................................... 148 Zdroje....................................................................................................... 151 SEZNAM TABULEK A OBRÁZKŮ.................................................. 153 JMENNÝ REJSTŘÍK................................................................................. 156 O AUTORECH............................................................................. 159
158 I Parlament s lidskou tváří JMENNÝ REJSTŘÍK в Babiš, Andrej 90,107 Babišová, Andrea 107 Balík, Stanislav 11 Bartoš, Ivan 109 Benda, Marek 98,118 Bernard, Josef 7 Besley, Timothy 9 Blatný, Fanni 49 Brim, Luboš 7 Broki, Lubomír 8 Broklová, Eva 41, 71,136 Brynychová, Ludmila 96 C Carbol, Jiří 9З Carnes, Nicholas 10 Č Calfa, Marian 77 Čip, René 97 Čižínský, Jan 94 D Drábek, Jaromír 102 Dufek, Pavel 7 F Fiala, Petr 7, ll, 45, 99 Filipec, Ondřej 8 Filip, Vojtěch 95 Fischer, Stanislav 96 G Gajdůšková, Alena 91 Gottwald, Klement 43 Grebeníček, Miroslav 96 Gross, Stanislav 85 H Hájek, Lukáš 10,113 Halíková, Milada 97 Hamáček, Jan 90 Hanuš, Jiří 93 Hlinka, Andrej 15,17, 28, 44, 51, 55, 58 Hodina, Franz 35 Hodinová-Spurná, Anežka 49 Hojda, Pavel 96 Holík, Jaroslav 105 Holík, Pavel 90 Horáková, Milada 48 Houzák, Josef 96 Hovorka, Luděk 9З Hrdý, Karel 85 Hrubý, Josef 44 Hubáčková, Gabriela 97 Huml, Stanislav 104 Husák, Jan 93 CH Chlad, Rudolf 102 Chlebounová, Anna 49 I Janda, Jakub 99 Janek, Michal 102
Jmenný rejstřík I 157 Juránek, Stanislav 94 Jurnečková-Vorlová, Marie 49 Mikešová, Renáta 7 Montalvo, José García 9 К N Nálepová, Marie 8 Nedvědová, Marie 97 Neki, Josef 97 Kalousek, Miroslav 79, 93 Karamazov, Simeon 99 Karpíšlcová, Betty 49 Kirpal, Irene 48 Klanica, Zdeněk 96 Klán, Jan 97 Kohlíček, Jaromír 96 Končická, Květa 97 Konečná, Kateřina 97 Kostelecký, Tomáš 7 Kouba, Karel 8 Kramář, Karel 36, 44 Kraus, Michal 84 Krejčí, Jan 58 Kroupa, Aleš 8 Krutáková, Jana 103 Křemen, Adolf 58 Křepek, František 44 Kvapil, Tomáš 93 L Laakso, Maarku 30 Landová-Štychová, Luisa 49 Linek, Lukáš 10 Lobkowicz, Jaroslav 93 Luft, Robert 7 Lupu, Noam 10 M Malypetr, Jan 28 Mansfledová, Zdenka 8 Marvanová, Hana 102 Masaryk, Tomáš Garrigue 36 Maštálka, Jiří 96 Medinger, Vilém 58 О Oberlik, Gustav 44 Okamura, Tornio 79,103-105 Onderka, Roman 91 P Pawlas, Daniei 97 Pechmanová-Klosová, Ludmila 49 Peters, Gustav 35 Pitkin, Hannah 6 Pleva, Petr 99 Podivínský, Tomáš 93 Poláková, Markéta 7 Prokůpelc, Adolf 58 Prolcůpek, Jan 58 Pružinský, Mikuláš 58 R Ransdorf, Miroslav 96 Raška, Miroslav 84 Reynal-Querol, Marta 9 Rozner, Miloslav 106 Rozsypalová, Augusta 48, 50 Rusnok, Jiří 94 Rusová, Marie 97 Rykała, Adam 90 Ř Řihák, Josef 90 Říha, Vladimír 93
158 I Parlament s lidskou tváří Sandner, Rudolf 44 Semelová, Marta 97 Scharnagl-Wiirl, Jiří 58 Schwarz, Bronislav 107 Schwarzenberg, Karel 102 Simm, Hugo 44 Śliwka, Karol 44 Snopek, Václav 97 Sochor, Vítězslav 85 Staněk, František 40 Svoboda, Cyril 93 Š Sídlo, Karel 97 Šimonovský, Milan 93 Škopík, Jan 93 Šlágr, Jiří 91 Šustr, Ladislav 93 Švehla, Antonín 23, 25, 36 T Taagepera, Rein зо Tollner, Pavel 84 Tomášek, František 36 Topolánek, Mirek 99 Tošovský, Josef 101 U Udržal, František 25 V Vacek, Miroslav 96 Válek, Vlastimil 102 Vicha, Josef 93 Vlčková, Miroslava 96 Volný, Jan 107 Výborný, Marek 94 Vykydal, Ivo 93 W Wagner, Jozef 85 Washington, Ebonya L. 10 Wenzel, Franz 58 Wollschack, Theodor 44 Z Zahradníček, Jan 84 Zahradník, Jan 99 Zapletal, Cyril 90 Zemínová, Františka (Fráňa) 48 Ž Žáček, Pavel 99
148 I Parlament s lidskou tváří SEZNAM POUŽITÉ LITERATURY A ZDROJŮ Literatura Askari, D., Wintr, J. (2017). Parlamentní obstrukce ve světle ústavněprávních diskusí. Správní právo - Legislativní příloha, 50(7-8), IO6-125. Bäck, H., Debus, M. (2019). When do women speak? A comparative analysis of the role of gender in legislative debates. Political Studies, 67(3), 576-596. Balík, S., Fiala, P. (2019). Československé volby 1935 a dolní parlamentní komora: rozdíly mezi poslanci pro-československých a antisystémových stran? Historický časopis (v tisku). Besley, T., Montalvo, J. G., Reynal-Querol, M. (2011). Do educated leaders matter? The Economic Journal, 121(554), F205-227· Bernard, Josef. 2012. Individuální charakteristiky kandidátů ve volbách do zastupitelstev obcí a jejich vliv na volební výsledky. Sociologický časopis/Czech Sociological Review, 48(4), 613 - 640. Bratton, К. A., Haynie, K. L. (1999). Agenda setting and legislative success in state legislatures: The effects of gender and race. The Journal of Politics, 61(3), 658-679. Brim, L., Dufek, P. (2012). Politická reprezentace individuální a kolektivní: К otázce teoretických základů demokracie na transnacionalni úrovni. Politologický časopis, 19(2), 128-154. Broki, L., Mansfeldová, Z., Kroupa, A. (1998). Poslanci prvního českého parlamentu (1992-96). Praha: Sociologický ústav AV ČR. Broki, L., Mansfeldová, Z., Seidlová, A. (2001). Vztah poslanců českého parlamentu к voličům jako problém vertikální odpovědnosti. Sociologický časopis 37 (З), 297-З11. ISSN 0038-0288. Broklová, E. (1992). Československá demokracie.
Politický systém ČSR1918-1938. Praha: Sociologické nakladatelství. Buršík, T. (2006). „Národu jsem vždy věrně sloužila a vědomě nikomu škodu neučinila. Františka Zeminová (1882-1962). Securitas imperii, 2006(14), 271-280. Carnes, N.. Lupu, N. (2015). Rethinking the comparative perspective on class and representation: Evidence from Latin America. American Journal of Political Science, 59(1), 1-18. Carnes, N.. Lupu, N. (2016). What good is a college degree? Education and leader quality reconsidered. The Journal of Politics, 78(l), 35-49.
Seznam použité literatury a zdrojů I 149 Fiala, P. (1987a). Sociální skladba české politické reprezentace na Moravě na počátku 20. století. Časopis matice moravské, 106(1-2), 52-71. Fiala, P. (1987b). Sociální struktura českého sněmovního zastoupení na Moravě zvoleného v zemských volbách roku 1902. Časopis matice moravské, 106(1-2), 52-71. Fiala, P. (1988). Zastoupení českých politických stran na moravském zemském sněmu na konci 19. století. Časopis matice moravské, 107(1-2), 61-80. Fiala, R, Holzer, J., Mareš, M., Pšeja, P. (1999). Komunismusv České republice. Vývojové, systémové a ideové aspekty působení KSČM a dalších komunistických organizací v české politice. Brno: MPÚ. Franck, R., Rainer, I. (2012). Does the leader’s ethnicity matter? Ethnic favoritism, education, and health in sub-Saharan Africa. American Political Science Review, 106(2), 294-325. Hájek, L. (2017). The effect of multiple-office holding on the parliamentary activity of MPs in the Czech Republic. The Journal of Legislative Studies, 23(4), 484-507. Hájek, L. (2019). Effects of age and tenure on MPs’ legislative behaviour in the Czech Republic. Thejournal of legislative Studies, 25(4), 553-575. Havlík, V., Voda, P. (2018). Cleavages, Protest or Voting for Hope? The Rise of Centrist Populist Parties in the Czech Republic. Swiss Political Science Review, 24(2), 161-186. Hloušek, V., Kopeček, L. (2004): Konfliktní demokracie. Moderní masová politika ve střední Evropě. Brno: MPU. Hloušek, V., Kopeček, L. (2010). Politické strany. Původ, ideologie a transformace politických stran v západní a střední Evropě.
Praha: Grada. Chattopadhyay, R., Duflo, E. (2004). Women as policy makers: Evidence from a randomized policy experiment in India. Econometrica, 72(5), 1409-1443Chytilek, R., Šedo, J., Lebeda, T., Čaloud, D. (2009). Volební systémy. Praha: Portál. Ilonszki, G., Edinger, M. (2007). Mps in Pos-Communist and Post-Soviet Nations: A Parliamentary Elite in the Making. Journal of Legislative Studies, 13(1): 142-163. Jones, M. P. (1997). Legislator gender and legislator policy priorities in the Argentine Chamber of Deputies and the United States House of Representatives. Policy Studies Journal, 25(4), 613-629. Karnik, Z. (2000). České země v éře První republiky, Dill. Vznik, budování a zlatá léta republiky (1918-1929). Praha: Libri. Karpowitz, C. F., Mendelberg, T. (2014). The Silent Sex: Gender, Deliberation, And Institutions. Princeton University Press. Klimek, A. (2000). Velké dějiny zemí Koruny české. Svazek XIII. 1918-1929. Praha, Litomyšl: Paseka.
150 I Parlament s lidskou tváří Klimek, A. (2002). Velké dějiny zemí Koruny české. SvazekXW. 1929-1938. Praha, Litomyšl: Paseka. Kouba, K., Nálepová, M., Filipec, O. (2013). Proč jsou ženy v české politice podreprezentovány? Analýza kandidátních listin a volebního chování v Olomouckém kraji. Politologický časopis, 20(4), 372-391. Linek, L. (2008). Kdy vymřou voliči KSČM? К věkové struktuře elektoratu KSČM. Politologický časopis/Czech journal of Political Science, 15(4), 318-336. Linek, L. (2009). Socio-demografická struktura poslanců a její vliv na politické postoje. In Mansfeldová, Z., Linek, L. (eds.). Český parlament ve druhé dekádě demokratického vývoje. Praha: Sociologický ústav AV ČR, 95-111. Luft, R. (1984). Tsechische Parlamentarier und die Prager Hochschulen (1907-1914). In Seibt, F. (ed.). Die Teilung der Prager Universität 1882 und die intellektuelle Desintegration in den böhmischen Ländern. München: Oldenbourg Wissenschaftsverlag, 147-171. Malíř, J. etai. (2012). Biografický slovník poslanců moravského zemského sněmu vletech 1861-1918. Brno: Centrum pro studium demokracie a kultury. Mansfeldová, Z. (2014). The Czech parliament on the road to professionalization and stabilization. In Semenova, E., Edinger, M. Best, H. (eds.). Parliamentary Elites in Central and Eastern Europe. Recruitment and Representation. London, New York: Routledge. Mikešová, R., Kostelecký, T. (2016). Geografická reprezentativita poslanců zvolených do Poslanecké sněmovny českého parlamentu za první republiky (1918-1938) a po roce 1989. Středoevropské politické studie, 18(4), 354-380. Neck,
R. (1968). Österreich im fahre 1918. Berichte und Dokumente. München: Oldenbourg. Nečásek, A. (1936). Poslanci a senátoři Národního shromáždění Republiky československé. Praha: Em. Stivín a synové. Novák, M. (1996). Volby do Poslanecké sněmovny, vládní nestabilita a perspektivy demokracie v ČR. Sociologický časopis, 32(4), 407-422. Pande, R. (2003). Can mandated political representation increase policy influence for disadvantaged minorities? Theory and evidence from India. American Economic Review, 93(4), 1132-1151. Pitkin, H. F. (1967). The Concept of Representation. University of California Press. Podiven. (1991). Češiv dějinách nové doby. Praha: Rozmluvy. Poláková, M., Kostelecký, T. (2016). Povolání zvolených poslanců za první republiky a dnes. Středoevropské politické studie, 18(1), 1-30. Rosenthal, C. S. (1998). Whenwomenlead: Integrative leadership instate legislatures. Oxford University Press. Schwindt-Bayer, L. A. (2006). Still supermadres? Gender and the policy priorities of Latin American legislators. American journal of Political Science, 50(3), 570-585.
Seznam použité literatury a zdrojů I 151 Spáč, P., Voda, P., Balík, S., Pink, M. (2018). Politika vykrmování na regionální úrovni. Případ dotací pro obce ve Středočeském kraji. Sociologicky časopis, 54(4), 499-528. Strmiska, M., Hloušek, V., Kopeček, L., Chytilek, R. (2005). Politické strany moderní Evropy. Analýza stranicko-politických systémů. Praha: Portál. Swers, M. L. (2001). Research on Women in Legislatures: What Have We Learned Where Are We Going? Women Politics, 23(1-2), 167-185. Swers, M. L. (2002). The Difference Women Make: The Policy Impact of Women in Congress. University of Chicago Press. Taylor-Robinson, M. M., Heath, R. M. (2003). Do women legislators have different policy priorities than their male colleagues? A critical case test. Women Politics, 24(4), 77-101. Tóth, A., Novotný, L., Stehlík, M. (2012). Národnostní menšiny v skoslovensku 1918-1938. Praha: Togga. Tvrdoň, J. (2015). Interpelace na český způsob. Online https://demagog.cz/diskuze/ interpelace-na-cesky-zpusob. Volden, C., Wiseman, A. E. (2014). Legislative effectiveness in the United States congress: The lawmakers. Cambridge University Press. Washington, E. L. (2008). Female socialization: how daughters affect their legislator fathers. American Economic Review, 98(1), 311-ՅՅ2· Ziegler, A. (2011). Úloha žen v prvních československých parlamentních volbách roku 1920 (diplomová práce). Dostupné na https://is.muni.cz/th/hg67b/. Zdroje Český statistický úřad. (2006). Volby do Národního shromáždění -1920 až 1935Dostupné na https://www.czso.cz/csu/czso/volby-do-narodniho-
shromazdeni1920-az-1935-n-2hwwxuf57q. Český statistický úřad. (2014). Úroveň vzdělání obyvatelstva podle výsledků satani lidu. Dostupné na https://www.czso.cz/documents/lOl80/20536250/170232i4. pdf/7545al5a-8565-458b-b4e3-e8bf43255bl2?version=l.l. Český statistický úřad. (2019). Přehled výsledků voleb do Národního shromáždění и období 1920-1935. Dostupné na https://www.czso.cz/. documents/lOl8o/20536230/4219rrc_2prehl.pdf/856bf2bc-774e-47dl-ba49b572f468a912?version=1.0. Česká správa sociálního zabezpečení. (2019). Počet OSVČv ČR. Dostupné na https:// data.essz.cz/web/otevrena-data/graf-pocet-osvc-v-cr. Databáze poslanců Národního shromáždění Republiky československé 1920-1935- Interní databáze FSS MU.
152 I Parlament s lidskou tváři Poslanecká sněmovna Parlamentu ČR. (2019a): Data Poslanecké sněmovny a Senátu. Poslanecká sněmovna Parlamentu ČR. (2019b). Společná československá digitální parlamentní knihovna. Dostupné na http://www.psp.cz/eknih/index.htm. Státní statistický úřad. (1924). Statistický lexikon obcí v Republice československé: úřední seznam míst podle zákona ze dne 14. dubna 1920, čís. 266 Sb. zák. a nař. I., Země česká. Praha: Orbis. Státní statistický úřad. (1927). Statistický lexikon obcí v Republice československé: úřední seznam míst podle zákona ze dne 14· dubna 1920, čís. 266 Sb. zák. a nař. III., Země slovenská. Praha: Orbis. Státní statistický úřad. (1928). Statistický lexikon obcí v Republice československé: úřední seznam míst podle zákona ze dne 14. dubna 1920, čís. 266 Sb. zák. a nař. II., Země moravskolezská. Praha: Orbis. Státní statistický úřad. (1930). Statistický přehled Republiky československé. Praha. Státní statistický úřad. (1937). Statistický lexikon obcí v Republice československé: úřední seznam míst podle zákona ze dne 14- dubna 1920, čís. 266 Sb. zák. a nař. IV., Země podkarpatoruská. Praha: Orbis. Volby.cz. Dostupné na https://www.volby.cz.
146 I Parlament s lidskou tváří SUMMARY This book examines the changing structure of the Czech parlia ment since 1920 in terms of its members professions. The first part is focused on the interwar period - years when the Czech lands were a very heterogeneous region. Beyond Czech political parties, their German and sometimes Polish counterparts enjoyed parlia mentary representation. The second part describes the nearly three decades since 1990, when free competition between political par ties was reintroduced and several hundred MPs sat in the legisla tures of the democratising Czechoslovakia. After a brief period the federation was replaced with a new entity, the present-day Czech Republic, where the most important elected body is the Chamber of Deputies, the lower chamber of the Parliament of the Czech Repub lic. To date (2019) there have been seven elections to the Chamber, in which 1,400 MPs have been elected. The third part analyses in greater detail the influence of MPs’ biographical histories on their activities and on democratic representation itself. The book acquaints readers with the mutability of the original profession of politician, so that they may acquire a clearer notion of who the MPs in the Czech parliament really are. Thus they will receive an answer to the question: what education, or profession, should one have if one’s strategic aim is to become an MP? Beyond describing the professional structure of the Chamber, the book pro vides details about MPs in terms of age, gender and education. Readers will become familiar with the profiles of MPs
elected on the many different party tickets, and this might help them decide how to cast their votes in the upcoming elections. Theoretically, the book is based on Hannah Pitkin’s concept of representation. The main sources of data are personal question naires filled by the MPs themselves, attendance lists and a free-
Summary I 147 ly-accessible database of the Czech Office for Statistics with de tailed information about MPs. A reflection of the current state of knowledge, drawing on scholarly literature published at home and abroad, forms an integral part of the book. The book shows that a century of modern Czech politics shows signs of continuity as well as indicators of change. We can certain ly claim that typical members of Czech parliaments were and are men in their forties, with higher (university) education and living in cities. The representation of women is low, but substantially higher in the post-November 1989 parliaments than under the First Republic (1918-1938). One of the main differences is that members elected after 1990 are much more often professional politicians. It is also true that the measure of members’ political experience has increased with time, either because a large proportion of MPs is re-elected or because local and regional politicians sit on the par liamentary benches. For the period after 1996, it can be argued that parliamentary activity - measured by the number of speech es - is fundamentally influenced by the MPs’ position in the party hierarchy, because MPs that have leading positions in their parties are much more active than others. It is also true that MPs having university degrees are much more active than their untitled col leagues. There are also differences between men and women, with the latter speaking in parliament less often than the former.
|
| any_adam_object | 1 |
| author | Balík, Stanislav 1956- Pink, Michal 1976- Voda, Petr |
| author_GND | (DE-588)143712969 (DE-588)1036806006 (DE-588)1206378395 |
| author_facet | Balík, Stanislav 1956- Pink, Michal 1976- Voda, Petr |
| author_role | aut aut aut |
| author_sort | Balík, Stanislav 1956- |
| author_variant | s b sb m p mp p v pv |
| building | Verbundindex |
| bvnumber | BV046627063 |
| ctrlnum | (OCoLC)1145196006 (DE-599)BVBBV046627063 |
| edition | 1. vydání |
| era | Geschichte 1920-2109 gnd |
| era_facet | Geschichte 1920-2109 |
| format | Book |
| fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>03340nam a2200637 cb4500</leader><controlfield tag="001">BV046627063</controlfield><controlfield tag="003">DE-604</controlfield><controlfield tag="005">20200617 </controlfield><controlfield tag="007">t|</controlfield><controlfield tag="008">200312s2019 xx |||| |||| 00||| cze d</controlfield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9788073254919</subfield><subfield code="9">978-80-7325-491-9</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9788021095045</subfield><subfield code="9">978-80-210-9504-5</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)1145196006</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-599)BVBBV046627063</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-604</subfield><subfield code="b">ger</subfield><subfield code="e">rda</subfield></datafield><datafield tag="041" ind1="0" ind2=" "><subfield code="a">cze</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-12</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">OST</subfield><subfield code="q">DE-12</subfield><subfield code="2">fid</subfield></datafield><datafield tag="100" ind1="1" ind2=" "><subfield code="a">Balík, Stanislav</subfield><subfield code="d">1956-</subfield><subfield code="e">Verfasser</subfield><subfield code="0">(DE-588)143712969</subfield><subfield code="4">aut</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Parlament s lidskou tváří</subfield><subfield code="b">biografické aspekty české legislativní politiky</subfield><subfield code="c">Stanislav Balík, Michal Pink, Petr Voda</subfield></datafield><datafield tag="250" ind1=" " ind2=" "><subfield code="a">1. vydání</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">Brno</subfield><subfield code="b">Centrum pro studium demokracie a kultury</subfield><subfield code="c">2019</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">Brno</subfield><subfield code="b">Masarykova univerzita</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">162 Seiten</subfield><subfield code="b">Diagramme</subfield><subfield code="c">21 cm</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="b">n</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="b">nc</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="490" ind1="1" ind2=" "><subfield code="a">Politologická řada</subfield><subfield code="v">svazek č. 77</subfield></datafield><datafield tag="500" ind1=" " ind2=" "><subfield code="a">Enthält 59 Tabellen</subfield></datafield><datafield tag="546" ind1=" " ind2=" "><subfield code="a">Zusammenfassung in englischer Sprache</subfield></datafield><datafield tag="648" ind1=" " ind2="7"><subfield code="a">Geschichte 1920-2109</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Abgeordneter</subfield><subfield code="0">(DE-588)4000135-0</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Parlament</subfield><subfield code="0">(DE-588)4044685-2</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Politik</subfield><subfield code="0">(DE-588)4046514-7</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="651" ind1=" " ind2="7"><subfield code="a">Tschechoslowakei</subfield><subfield code="0">(DE-588)4078435-6</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="651" ind1=" " ind2="7"><subfield code="a">Tschechien</subfield><subfield code="0">(DE-588)4303381-7</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="689" ind1="0" ind2="0"><subfield code="a">Tschechoslowakei</subfield><subfield code="0">(DE-588)4078435-6</subfield><subfield code="D">g</subfield></datafield><datafield tag="689" ind1="0" ind2="1"><subfield code="a">Tschechien</subfield><subfield code="0">(DE-588)4303381-7</subfield><subfield code="D">g</subfield></datafield><datafield tag="689" ind1="0" ind2="2"><subfield code="a">Politik</subfield><subfield code="0">(DE-588)4046514-7</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="3"><subfield code="a">Parlament</subfield><subfield code="0">(DE-588)4044685-2</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="4"><subfield code="a">Abgeordneter</subfield><subfield code="0">(DE-588)4000135-0</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="5"><subfield code="a">Geschichte 1920-2109</subfield><subfield code="A">z</subfield></datafield><datafield tag="689" ind1="0" ind2=" "><subfield code="5">DE-604</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Pink, Michal</subfield><subfield code="d">1976-</subfield><subfield code="e">Verfasser</subfield><subfield code="0">(DE-588)1036806006</subfield><subfield code="4">aut</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Voda, Petr</subfield><subfield code="e">Verfasser</subfield><subfield code="0">(DE-588)1206378395</subfield><subfield code="4">aut</subfield></datafield><datafield tag="830" ind1=" " ind2="0"><subfield code="a">Politologická řada</subfield><subfield code="v">svazek č. 77</subfield><subfield code="w">(DE-604)BV013246254</subfield><subfield code="9">77</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">Digitalisierung BSB München 25 - ADAM Catalogue Enrichment</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=032038675&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Inhaltsverzeichnis</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">Digitalisierung BSB München 25 - ADAM Catalogue Enrichment</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=032038675&sequence=000003&line_number=0002&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Register // Personenregister</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">Digitalisierung BSB München 25 - ADAM Catalogue Enrichment</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=032038675&sequence=000005&line_number=0003&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Literaturverzeichnis</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">Digitalisierung BSB München 25 - ADAM Catalogue Enrichment</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=032038675&sequence=000007&line_number=0004&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Abstract</subfield></datafield><datafield tag="940" ind1="1" ind2=" "><subfield code="n">oe</subfield></datafield><datafield tag="940" ind1="1" ind2=" "><subfield code="q">BSB_NED_20200617</subfield></datafield><datafield tag="942" ind1="1" ind2="1"><subfield code="c">909</subfield><subfield code="e">22/bsb</subfield><subfield code="f">0904</subfield><subfield code="g">4371</subfield></datafield><datafield tag="942" ind1="1" ind2="1"><subfield code="c">909</subfield><subfield code="e">22/bsb</subfield><subfield code="f">090511</subfield><subfield code="g">4371</subfield></datafield><datafield tag="942" ind1="1" ind2="1"><subfield code="c">909</subfield><subfield code="e">22/bsb</subfield><subfield code="f">090512</subfield><subfield code="g">4371</subfield></datafield><datafield tag="943" ind1="1" ind2=" "><subfield code="a">oai:aleph.bib-bvb.de:BVB01-032038675</subfield></datafield></record></collection> |
| geographic | Tschechoslowakei (DE-588)4078435-6 gnd Tschechien (DE-588)4303381-7 gnd |
| geographic_facet | Tschechoslowakei Tschechien |
| id | DE-604.BV046627063 |
| illustrated | Not Illustrated |
| indexdate | 2024-12-20T18:56:40Z |
| institution | BVB |
| isbn | 9788073254919 9788021095045 |
| language | Czech |
| oai_aleph_id | oai:aleph.bib-bvb.de:BVB01-032038675 |
| oclc_num | 1145196006 |
| open_access_boolean | |
| owner | DE-12 |
| owner_facet | DE-12 |
| physical | 162 Seiten Diagramme 21 cm |
| psigel | BSB_NED_20200617 |
| publishDate | 2019 |
| publishDateSearch | 2019 |
| publishDateSort | 2019 |
| publisher | Centrum pro studium demokracie a kultury Masarykova univerzita |
| record_format | marc |
| series | Politologická řada |
| series2 | Politologická řada |
| spellingShingle | Balík, Stanislav 1956- Pink, Michal 1976- Voda, Petr Parlament s lidskou tváří biografické aspekty české legislativní politiky Politologická řada Abgeordneter (DE-588)4000135-0 gnd Parlament (DE-588)4044685-2 gnd Politik (DE-588)4046514-7 gnd |
| subject_GND | (DE-588)4000135-0 (DE-588)4044685-2 (DE-588)4046514-7 (DE-588)4078435-6 (DE-588)4303381-7 |
| title | Parlament s lidskou tváří biografické aspekty české legislativní politiky |
| title_auth | Parlament s lidskou tváří biografické aspekty české legislativní politiky |
| title_exact_search | Parlament s lidskou tváří biografické aspekty české legislativní politiky |
| title_full | Parlament s lidskou tváří biografické aspekty české legislativní politiky Stanislav Balík, Michal Pink, Petr Voda |
| title_fullStr | Parlament s lidskou tváří biografické aspekty české legislativní politiky Stanislav Balík, Michal Pink, Petr Voda |
| title_full_unstemmed | Parlament s lidskou tváří biografické aspekty české legislativní politiky Stanislav Balík, Michal Pink, Petr Voda |
| title_short | Parlament s lidskou tváří |
| title_sort | parlament s lidskou tvari biograficke aspekty ceske legislativni politiky |
| title_sub | biografické aspekty české legislativní politiky |
| topic | Abgeordneter (DE-588)4000135-0 gnd Parlament (DE-588)4044685-2 gnd Politik (DE-588)4046514-7 gnd |
| topic_facet | Abgeordneter Parlament Politik Tschechoslowakei Tschechien |
| url | http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=032038675&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=032038675&sequence=000003&line_number=0002&func_code=DB_RECORDS&service_type=MEDIA http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=032038675&sequence=000005&line_number=0003&func_code=DB_RECORDS&service_type=MEDIA http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=032038675&sequence=000007&line_number=0004&func_code=DB_RECORDS&service_type=MEDIA |
| volume_link | (DE-604)BV013246254 |
| work_keys_str_mv | AT balikstanislav parlamentslidskoutvaribiografickeaspektyceskelegislativnipolitiky AT pinkmichal parlamentslidskoutvaribiografickeaspektyceskelegislativnipolitiky AT vodapetr parlamentslidskoutvaribiografickeaspektyceskelegislativnipolitiky |