Gardens of the Roman Empire:
Gespeichert in:
| Weitere beteiligte Personen: | , , , |
|---|---|
| Format: | Buch |
| Sprache: | Englisch |
| Veröffentlicht: |
Cambridge, United Kingdom
Cambridge University Press
2018
|
| Schlagwörter: | |
| Links: | http://www.sehepunkte.de/2020/02/32932.html http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=030256917&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |
| Beschreibung: | Includes bibliographical references and index |
| Umfang: | xxxvi, 617 Seiten Illustrationen, Diagramme, Karten, Pläne |
| ISBN: | 9780521821612 |
Internformat
MARC
| LEADER | 00000nam a2200000 c 4500 | ||
|---|---|---|---|
| 001 | BV044862266 | ||
| 003 | DE-604 | ||
| 005 | 20190108 | ||
| 007 | t| | ||
| 008 | 180312s2018 xx a||| |||| 00||| eng d | ||
| 020 | |a 9780521821612 |c hardback |9 978-0-521-82161-2 | ||
| 035 | |a (OCoLC)1029851777 | ||
| 035 | |a (DE-599)GBV881115118 | ||
| 040 | |a DE-604 |b ger |e rda | ||
| 041 | 0 | |a eng | |
| 049 | |a DE-11 |a DE-384 |a DE-20 |a DE-19 |a DE-Y3 |a DE-Y2 |a DE-824 |a DE-355 |a DE-M491 | ||
| 084 | |a LG 2000 |0 (DE-625)92092: |2 rvk | ||
| 084 | |a LG 8300 |0 (DE-625)92180: |2 rvk | ||
| 084 | |a NH 7325 |0 (DE-625)125773: |2 rvk | ||
| 245 | 1 | 0 | |a Gardens of the Roman Empire |c edited by Wilhelmina F. Jashemski, Kathryn L. Gleason (Cornell University, New York), Kim J. Hartswick (City University of New York), Amina-Aïcha Malek (The National Center for Scientific Research CNRS, France) |
| 264 | 1 | |a Cambridge, United Kingdom |b Cambridge University Press |c 2018 | |
| 300 | |a xxxvi, 617 Seiten |b Illustrationen, Diagramme, Karten, Pläne | ||
| 336 | |b txt |2 rdacontent | ||
| 337 | |b n |2 rdamedia | ||
| 338 | |b nc |2 rdacarrier | ||
| 500 | |a Includes bibliographical references and index | ||
| 650 | 0 | 7 | |a Gartenkunst |0 (DE-588)4125179-9 |2 gnd |9 rswk-swf |
| 650 | 0 | 7 | |a Archäologie |0 (DE-588)4002827-6 |2 gnd |9 rswk-swf |
| 650 | 0 | 7 | |a Garten |0 (DE-588)4019286-6 |2 gnd |9 rswk-swf |
| 651 | 7 | |a Römisches Reich |0 (DE-588)4076778-4 |2 gnd |9 rswk-swf | |
| 655 | 7 | |0 (DE-588)4143413-4 |a Aufsatzsammlung |2 gnd-content | |
| 688 | 7 | |a Gartenbau |0 (DE-2581)TH000007020 |2 gbd | |
| 688 | 7 | |a Gärten, archäologisch |0 (DE-2581)TH000008059 |2 gbd | |
| 688 | 7 | |a Kulturgeschichte der Antike |0 (DE-2581)TH000005829 |2 gbd | |
| 689 | 0 | 0 | |a Römisches Reich |0 (DE-588)4076778-4 |D g |
| 689 | 0 | 1 | |a Garten |0 (DE-588)4019286-6 |D s |
| 689 | 0 | 2 | |a Gartenkunst |0 (DE-588)4125179-9 |D s |
| 689 | 0 | 3 | |a Archäologie |0 (DE-588)4002827-6 |D s |
| 689 | 0 | |5 DE-604 | |
| 700 | 1 | |a Jashemski, Wilhelmina Mary Feemster |d 1910-2007 |0 (DE-588)118908375 |4 edt | |
| 700 | 1 | |a Gleason, Kathryn |0 (DE-588)1034562223 |4 edt | |
| 700 | 1 | |a Hartswick, Kim J. |4 edt | |
| 700 | 1 | |a Malek, Amina-Aïcha |0 (DE-588)1035226529 |4 edt | |
| 856 | 4 | 2 | |u http://www.sehepunkte.de/2020/02/32932.html |y rezensiert in: sehepunkte 20 (2020), Nr. 2 |3 Rezension |
| 856 | 4 | 2 | |m Digitalisierung UB Augsburg - ADAM Catalogue Enrichment |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=030256917&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |3 Inhaltsverzeichnis |
| 940 | 1 | |n gbd | |
| 940 | 1 | |q gbd_4_1805 | |
| 943 | 1 | |a oai:aleph.bib-bvb.de:BVB01-030256917 | |
Datensatz im Suchindex
| _version_ | 1819281906655559680 |
|---|---|
| adam_text | CONTENTS
List of Illustrations page x
List of Tables xxix
List of Contributors xxx
Acknowledgments xxxiii
Introduction
~Wilhelmina F. Jashemski, Kathryn L. Gleason,
Kim J. Hartswick, and Amina-Aicha Malek 1
Part I The Main Types of Gardens
CHAPTER 1
The Garden in the Domus
~ Eric Morvillez 17
CHAPTER 2
The Roman Villa Garden
~ Kim J. Hartswick 72
Vlll h- CONTENTS
CHAPTER 3
The Archaeology of Gardens in the Roman Villa
— Elizabeth Macaulay-Lewis 87
CHAPTER 4
Produce Gardens
— Wilhelmina F. Jashemski 121
CHAPTER 5
Temple Gardens and Sacred Groves
— Maureen Carroll 152
CHAPTER 6
Gardens in Baths and Palaestras
—J anet DeLaine 165
CHAPTER 7
Gardens in Gymnasia, Schools, and Scholae
—Maureen Carroll 185
CHAPTER 8
Roman Tomb Gardens
—JohnBodel 199
Part II The Experience of Gardens as Revealed
by Literature and Art
CHAPTER 9
Greek Literary Evidence for Roman Gardens
— Antony R. Little wood 245
CHAPTER 10
Representations of Gardens in Roman Literature
— K. Sara Myers 258
CHAPTER 11
Frescoes in Roman Gardens
—Bettina Bergmann 278
CONTENTS —f IX
CHAPTER 12
Mosaics and Nature in the Roman Domus
~ Amina-A icha Malek 317
CHAPTER 13
Sculpture in Ancient Roman Gardens
— Kim J. Hartswick 341
Part III Making the Garden
CHAPTER 14
Constructing the Ancient Roman Garden
— Kathryn L. Gleason and Michele A. Palmer 369
CHAPTER 15
Water and Water Technology in Roman Gardens
— Gemma C. M. Jansen 402
CHAPTER 16
Gardening Practices and Techniques
— Wilhelmina F. Jashemski 432
CHAPTER 17
Plants of the Roman Garden
—Wilhelmina F. Jashemski,
Kathryn L. Gleason, and Michael Herchenbach 455
CHAPTER 18
Conclusions: New Perspectives on the Roman Garden
— Kathryn L. Gleason, Kim J. Hartswick,
Amina-A icha Malek, and Michele A. Palmer 481
Notes 495
Glossary 331
Bibliography 334
Index 603
Additional resources for this publication at
www. Cambridge. org/9780321821612
|
| any_adam_object | 1 |
| author2 | Jashemski, Wilhelmina Mary Feemster 1910-2007 Gleason, Kathryn Hartswick, Kim J. Malek, Amina-Aïcha |
| author2_role | edt edt edt edt |
| author2_variant | w m f j wmf wmfj k g kg k j h kj kjh a a m aam |
| author_GND | (DE-588)118908375 (DE-588)1034562223 (DE-588)1035226529 |
| author_facet | Jashemski, Wilhelmina Mary Feemster 1910-2007 Gleason, Kathryn Hartswick, Kim J. Malek, Amina-Aïcha |
| building | Verbundindex |
| bvnumber | BV044862266 |
| classification_rvk | LG 2000 LG 8300 NH 7325 |
| ctrlnum | (OCoLC)1029851777 (DE-599)GBV881115118 |
| discipline | Geschichte Klassische Archäologie |
| format | Book |
| fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>02601nam a2200541 c 4500</leader><controlfield tag="001">BV044862266</controlfield><controlfield tag="003">DE-604</controlfield><controlfield tag="005">20190108 </controlfield><controlfield tag="007">t|</controlfield><controlfield tag="008">180312s2018 xx a||| |||| 00||| eng d</controlfield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9780521821612</subfield><subfield code="c">hardback</subfield><subfield code="9">978-0-521-82161-2</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)1029851777</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-599)GBV881115118</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-604</subfield><subfield code="b">ger</subfield><subfield code="e">rda</subfield></datafield><datafield tag="041" ind1="0" ind2=" "><subfield code="a">eng</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-11</subfield><subfield code="a">DE-384</subfield><subfield code="a">DE-20</subfield><subfield code="a">DE-19</subfield><subfield code="a">DE-Y3</subfield><subfield code="a">DE-Y2</subfield><subfield code="a">DE-824</subfield><subfield code="a">DE-355</subfield><subfield code="a">DE-M491</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">LG 2000</subfield><subfield code="0">(DE-625)92092:</subfield><subfield code="2">rvk</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">LG 8300</subfield><subfield code="0">(DE-625)92180:</subfield><subfield code="2">rvk</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">NH 7325</subfield><subfield code="0">(DE-625)125773:</subfield><subfield code="2">rvk</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Gardens of the Roman Empire</subfield><subfield code="c">edited by Wilhelmina F. Jashemski, Kathryn L. Gleason (Cornell University, New York), Kim J. Hartswick (City University of New York), Amina-Aïcha Malek (The National Center for Scientific Research CNRS, France)</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">Cambridge, United Kingdom</subfield><subfield code="b">Cambridge University Press</subfield><subfield code="c">2018</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">xxxvi, 617 Seiten</subfield><subfield code="b">Illustrationen, Diagramme, Karten, Pläne</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="b">n</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="b">nc</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="500" ind1=" " ind2=" "><subfield code="a">Includes bibliographical references and index</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Gartenkunst</subfield><subfield code="0">(DE-588)4125179-9</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Archäologie</subfield><subfield code="0">(DE-588)4002827-6</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Garten</subfield><subfield code="0">(DE-588)4019286-6</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="651" ind1=" " ind2="7"><subfield code="a">Römisches Reich</subfield><subfield code="0">(DE-588)4076778-4</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="655" ind1=" " ind2="7"><subfield code="0">(DE-588)4143413-4</subfield><subfield code="a">Aufsatzsammlung</subfield><subfield code="2">gnd-content</subfield></datafield><datafield tag="688" ind1=" " ind2="7"><subfield code="a">Gartenbau</subfield><subfield code="0">(DE-2581)TH000007020</subfield><subfield code="2">gbd</subfield></datafield><datafield tag="688" ind1=" " ind2="7"><subfield code="a">Gärten, archäologisch</subfield><subfield code="0">(DE-2581)TH000008059</subfield><subfield code="2">gbd</subfield></datafield><datafield tag="688" ind1=" " ind2="7"><subfield code="a">Kulturgeschichte der Antike</subfield><subfield code="0">(DE-2581)TH000005829</subfield><subfield code="2">gbd</subfield></datafield><datafield tag="689" ind1="0" ind2="0"><subfield code="a">Römisches Reich</subfield><subfield code="0">(DE-588)4076778-4</subfield><subfield code="D">g</subfield></datafield><datafield tag="689" ind1="0" ind2="1"><subfield code="a">Garten</subfield><subfield code="0">(DE-588)4019286-6</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="2"><subfield code="a">Gartenkunst</subfield><subfield code="0">(DE-588)4125179-9</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="3"><subfield code="a">Archäologie</subfield><subfield code="0">(DE-588)4002827-6</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2=" "><subfield code="5">DE-604</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Jashemski, Wilhelmina Mary Feemster</subfield><subfield code="d">1910-2007</subfield><subfield code="0">(DE-588)118908375</subfield><subfield code="4">edt</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Gleason, Kathryn</subfield><subfield code="0">(DE-588)1034562223</subfield><subfield code="4">edt</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Hartswick, Kim J.</subfield><subfield code="4">edt</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Malek, Amina-Aïcha</subfield><subfield code="0">(DE-588)1035226529</subfield><subfield code="4">edt</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="u">http://www.sehepunkte.de/2020/02/32932.html</subfield><subfield code="y">rezensiert in: sehepunkte 20 (2020), Nr. 2</subfield><subfield code="3">Rezension</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">Digitalisierung UB Augsburg - ADAM Catalogue Enrichment</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=030256917&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Inhaltsverzeichnis</subfield></datafield><datafield tag="940" ind1="1" ind2=" "><subfield code="n">gbd</subfield></datafield><datafield tag="940" ind1="1" ind2=" "><subfield code="q">gbd_4_1805</subfield></datafield><datafield tag="943" ind1="1" ind2=" "><subfield code="a">oai:aleph.bib-bvb.de:BVB01-030256917</subfield></datafield></record></collection> |
| genre | (DE-588)4143413-4 Aufsatzsammlung gnd-content |
| genre_facet | Aufsatzsammlung |
| geographic | Römisches Reich (DE-588)4076778-4 gnd |
| geographic_facet | Römisches Reich |
| id | DE-604.BV044862266 |
| illustrated | Illustrated |
| indexdate | 2024-12-20T18:12:37Z |
| institution | BVB |
| isbn | 9780521821612 |
| language | English |
| oai_aleph_id | oai:aleph.bib-bvb.de:BVB01-030256917 |
| oclc_num | 1029851777 |
| open_access_boolean | |
| owner | DE-11 DE-384 DE-20 DE-19 DE-BY-UBM DE-Y3 DE-Y2 DE-824 DE-355 DE-BY-UBR DE-M491 |
| owner_facet | DE-11 DE-384 DE-20 DE-19 DE-BY-UBM DE-Y3 DE-Y2 DE-824 DE-355 DE-BY-UBR DE-M491 |
| physical | xxxvi, 617 Seiten Illustrationen, Diagramme, Karten, Pläne |
| psigel | gbd_4_1805 |
| publishDate | 2018 |
| publishDateSearch | 2018 |
| publishDateSort | 2018 |
| publisher | Cambridge University Press |
| record_format | marc |
| spellingShingle | Gardens of the Roman Empire Gartenkunst (DE-588)4125179-9 gnd Archäologie (DE-588)4002827-6 gnd Garten (DE-588)4019286-6 gnd |
| subject_GND | (DE-588)4125179-9 (DE-588)4002827-6 (DE-588)4019286-6 (DE-588)4076778-4 (DE-588)4143413-4 |
| title | Gardens of the Roman Empire |
| title_auth | Gardens of the Roman Empire |
| title_exact_search | Gardens of the Roman Empire |
| title_full | Gardens of the Roman Empire edited by Wilhelmina F. Jashemski, Kathryn L. Gleason (Cornell University, New York), Kim J. Hartswick (City University of New York), Amina-Aïcha Malek (The National Center for Scientific Research CNRS, France) |
| title_fullStr | Gardens of the Roman Empire edited by Wilhelmina F. Jashemski, Kathryn L. Gleason (Cornell University, New York), Kim J. Hartswick (City University of New York), Amina-Aïcha Malek (The National Center for Scientific Research CNRS, France) |
| title_full_unstemmed | Gardens of the Roman Empire edited by Wilhelmina F. Jashemski, Kathryn L. Gleason (Cornell University, New York), Kim J. Hartswick (City University of New York), Amina-Aïcha Malek (The National Center for Scientific Research CNRS, France) |
| title_short | Gardens of the Roman Empire |
| title_sort | gardens of the roman empire |
| topic | Gartenkunst (DE-588)4125179-9 gnd Archäologie (DE-588)4002827-6 gnd Garten (DE-588)4019286-6 gnd |
| topic_facet | Gartenkunst Archäologie Garten Römisches Reich Aufsatzsammlung |
| url | http://www.sehepunkte.de/2020/02/32932.html http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=030256917&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |
| work_keys_str_mv | AT jashemskiwilhelminamaryfeemster gardensoftheromanempire AT gleasonkathryn gardensoftheromanempire AT hartswickkimj gardensoftheromanempire AT malekaminaaicha gardensoftheromanempire |