Stylistyczna różnorodność w twórczości Christlieba Siegmunda Bindera: na przykładzie zbioru Sonat klawesynowych op. 1 – między barokiem a klasycyzmem = Stylistic diversity in Christlieb Siegmund Binder's works as exemplified by the Collection of Harpsichord Sonatas Op. 1 : between the Baroque and Classical Periods = Stilistische Vielfalt in dem Werk von Christlieb Siegmund Binder am Beispiel der Sonatensammlung für Cembalo op. 1 : zwischen Barock und Klassizismus
Gespeichert in:
Internformat
MARC
| LEADER | 00000nam a2200000 c 4500 | ||
|---|---|---|---|
| 001 | BV044752963 | ||
| 003 | DE-604 | ||
| 005 | 20181212 | ||
| 007 | t| | ||
| 008 | 180208s2017 xx agl| |||| 00||| pol d | ||
| 020 | |a 9788370992156 |9 978-83-7099-215-6 | ||
| 035 | |a (OCoLC)1045359247 | ||
| 035 | |a (DE-599)BVBBV044752963 | ||
| 040 | |a DE-604 |b ger |e rda | ||
| 041 | 0 | |a pol | |
| 049 | |a DE-12 | ||
| 084 | |a MUS |q DE-12 |2 fid | ||
| 100 | 1 | |a Tkaczyk, Paulina |e Verfasser |0 (DE-588)1151236713 |4 aut | |
| 245 | 1 | 0 | |a Stylistyczna różnorodność w twórczości Christlieba Siegmunda Bindera |b na przykładzie zbioru Sonat klawesynowych op. 1 – między barokiem a klasycyzmem = Stylistic diversity in Christlieb Siegmund Binder's works as exemplified by the Collection of Harpsichord Sonatas Op. 1 : between the Baroque and Classical Periods = Stilistische Vielfalt in dem Werk von Christlieb Siegmund Binder am Beispiel der Sonatensammlung für Cembalo op. 1 : zwischen Barock und Klassizismus |c Paulina Tkaczyk |
| 246 | 1 | 1 | |a Stylistic diversity in Christlieb Siegmund Binder's works as exemplified by the Collection of Harpsichord Sonatas Op. 1 |
| 246 | 1 | 1 | |a Stilistische Vielfalt in dem Werk von Christlieb Siegmund Binder am Beispiel der Sonatensammlung für Cembalo op. 1 |
| 264 | 1 | |a Kraków |b Musica Iagellonica |c 2017 | |
| 300 | |a 190 Seiten |b Illustrationen, Diagramme, Notenbeispiele | ||
| 336 | |b txt |2 rdacontent | ||
| 337 | |b n |2 rdamedia | ||
| 338 | |b nc |2 rdacarrier | ||
| 546 | |a Zusammenfassung in Englisch und Deutsch | ||
| 600 | 1 | 7 | |a Binder, Christlieb Siegmund |d 1723-1789 |0 (DE-588)122849108 |2 gnd |9 rswk-swf |
| 689 | 0 | 0 | |a Binder, Christlieb Siegmund |d 1723-1789 |0 (DE-588)122849108 |D p |
| 689 | 0 | |5 DE-604 | |
| 856 | 4 | 2 | |m Digitalisierung BSB München 19 - ADAM Catalogue Enrichment |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=030148571&sequence=000006&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |3 Inhaltsverzeichnis |
| 856 | 4 | 2 | |m Digitalisierung BSB München 19 - ADAM Catalogue Enrichment |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=030148571&sequence=000007&line_number=0002&func_code=DB_RECORDS&service_type=MEDIA |3 Literaturverzeichnis |
| 856 | 4 | 2 | |m Digitalisierung BSB München 19 - ADAM Catalogue Enrichment |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=030148571&sequence=000008&line_number=0003&func_code=DB_RECORDS&service_type=MEDIA |3 Register // Personenregister |
| 856 | 4 | 2 | |m Digitalisierung BSB München 19 - ADAM Catalogue Enrichment |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=030148571&sequence=000009&line_number=0004&func_code=DB_RECORDS&service_type=MEDIA |3 Abstract |
| 856 | 4 | 2 | |m Digitalisierung BSB München 19 - ADAM Catalogue Enrichment |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=030148571&sequence=000010&line_number=0005&func_code=DB_RECORDS&service_type=MEDIA |3 Abstract |
| 940 | 1 | |n oe | |
| 942 | 1 | 1 | |c 780.9 |e 22/bsb |f 09033 |g 438 |
| 942 | 1 | 1 | |c 780.9 |e 22/bsb |f 09033 |g 43 |
| 943 | 1 | |a oai:aleph.bib-bvb.de:BVB01-030148571 | |
Datensatz im Suchindex
| _version_ | 1819379787920048128 |
|---|---|
| adam_text | (¿Aiojemu
cWlod%imierzo wi
poswiçcam
Spis tresci
Wprowadzenie............................................................. 7
Rozdzial I
Osiemnastowieczne Drezno — europejski osrodek kultury.................... 11
1. Tío historyczne i kulturalne Drezna w XVIII wieku.............. 11
2. Zycie muzyczne Drezna w XVIII wieku ........................... 25
2.1. Muzyka na dworze Sasów....................................... 25
2.2. Muzyka koscielna i miejska................................... 34
2.3. Inne przejawy zycia muzycznego............................... 39
3. Muzyczne upodobania Fryderyka Augusta III........................ 40
4. Rys biograficzny Christlieba Siegmunda Bindera — drezdeñskiego
kompozytora i instrumentalisty....................................... 46
5. Binder dzis ..................................................... 56
Rozdzial II
Sonata — wybrane zagadnienia z historii gatunku XVI—XVIII wieku........ 59
1. Zagadnienia terminologiczne....................................... 59
2. Zagadnienia ogólne............................................... 62
3. Sonata na instrumenty klawiszowe w XVIII wieku ................ 64
4. Forma sonatowa.................................................. 67
Rozdzial III
Zbiór Sonat klawesyno ivych op. 1 Christlieba Siegmunda Bindera
jako fenomen artystyczny................................................. 71
1. Sonata I F-dur .................................................. 74
2. Sonata IID-dur .................................................. 84
6
Spis tresci
3. Sonata III c-moll............................................... 94
4. Sonata IVE-dur..................................................106
5. Sonata Va-moll..................................................114
6. Sonata VI B-dur.................................................125
Rozdzial IV
Kunszt kompozytorski Christlieba Siegmunda Bindera na przykladzie
zbioru Sonat klawesynovoych op. 1......................................136
1. XVIII wiek — narodziny nowej estetyki muzycznej — wybrane
zagadnienia stylistyczne ..........................................136
2. Prezentacja zbioru Sonat kla^wesynowych op. 1 Christlieba Siegmunda
Bindera ...........................................................140
Aneks. Zestawienie tabelaryczne .......................................153
Bibliografía...........................................................172
Indeks osób............................................................177
Wykaz tabel ...........................................................182
Wykaz rçkopisow........................................................182
Wykaz rycin............................................................183
Wykaz map..............................................................183
Streszczenie
Zusammenf;
Summary .
..185
..187
..189
Bibliografía
Publikacje ksi^zkowe
Bach, Carl Philipp Emanuel, Versuch über die Wahre Art, das Clavier zu spielen, red. Wolfgang
Horn, II wyd. faks. — reprint wyd. cz. I, Berlin 1753 (z uzup. z wyd. Leipzig 1787) i cz. II,
Berlin 1762 (z uzup. z wyd.Leipzig 1797), Kassel, Basel, London, New York, Prag 2003.
Bukofzer, Manfred, Muzyka za epoce baroku: od Monteverdiego do Bacha, przel. Elzbieta
Dzi^bowska, Warszawa 1970.
Engländer, Richard, Die Dresdner Instrumentalmusik in der Zeit der Wiener Klassik, Uppsala
1956.
Feicht, Hieronim, Studia nad muzykqpolskiego renesansu i baroku, Krakow 1980.
Fleischer, Heinrich, Christlieb Siegmund Binder (1723-1789): mit 74 Notenbeispielen und einem
thematischen Verzeichnis sämtlicher Werke, Regensburg 1941.
Fubini, Enrico, Historia estetyki muzycznej, przel. Zbigniew Skowron, Krakow 1997.
Golianek, Ryszard [red.], Strözynska, Beata [red.], Mozart i zaspolczes ni: muzyka za Europie
srodkozaej zu XVIII zuieku, Lodz 2007.
Harnoncourt, Nikolaus, Dialog muzyczny: rozzaazania o Monteverdim, Bachu i Mozarcie, przel.
Magdalena Czajka, Warszawa 1999.
— Muzyka mozaq dzzaigköza, przel. Magdalena Czajka, Warszawa 1995.
Hogwood, Christopher, Händel, przel. Barbara Swiderska, Krakow 2009.
M^dry, Alina, Carl Philipp Emanuel Bach: estetyka, stylistyka, dzielo, Poznan 2003.
Mizerska-Golonek, Ewa; Targosz, Jacek, Forma sonatovua: ogölna koncepcja formy: tektonika
i architektonika tematu sonatowego, Krakow 1997.
— Wprozaadzenie do analizy formy sonatovuej: ksztaltozaanie materialu dzzaigkozuego a przebieg
napigc zu muzyce klasycznej, Krakow 1987.
Rosenmüller, Annegret, Die Überlieferung der Clavierkonzerte in der Königlichen Privatmusika-
liensammlung zu Dresden im letzten Drittel des 18. Jahrhunderts, Eisenach 2002.
Szlagowska, Danuta, Muzyka baroku, Gdansk 1998.
Staszewski, Jacek, yf«gm////, Warszawa dr. 1986.
— Polacy zu osiemnastowiecznym Dreznie, Wroclaw 1986.
— Wettynozuie, Olsztyn 2005.
Strözynska, Beata, Drezdenska sonata na instrumenty klavoiszovue za drugiej polozvie XVIII zaie-
ku, Lodz 2002.
Szwedowska, Jadwiga [oprac.], Muzyka za czasopismachpolskich XVIII zaieku: okres saski (1730-
1764): bibliografia i antologia, Krakow dr. 1975.
Bibliografía
173
Tomaszewski, Mieczyslaw, Interpretacja integralna dzida muzycznego: rekonesans, Krakow
2000.
Zörawska-Witkowska, Alina, Muzyczne podröze krölewiczöw pohkich: cztery studia z dziejow
kultury muzycznej XVII i XVIII wiekuy Warszawa 1992.
— Muzyka na dworze Augusta II w Warszawie, Warszawa 1997.
Rozdzialy z ksigzek
Edler, Arnfried, Sonatenprinzip und Klaviersonate, [w:] idem, Gattungen der Musik fiir Tasten-
instrumente y Teil 2: Von 1750 bis 1830, Laaber 2003, s. 103—149.
Falck, Martin, Erstes Amt. Zeit des freiesten instrumentalen Schaffens, [w:] idem, Wilhelm Frie-
demann Bach: sein Leben und seine Werke, Leipzig 1913, s. 11—21.
Fürstenau, Moritz, KapelT und Kammermusik, [w:] idem, Zur Geschichte der Musik und des
Theaters am Hofe zu Dresden, Leipzig 1971, s. 294—295.
Hartwig, Dieter, Das Kreuzkantorat der Bach-Zeit: Theodor Christlieb Reinhold (1720—1755),
[w:] Der Dresdner Kreuzchor, red. Dieter Härtwig, Matthias Herrmann, Leipzig 2006, s.
56-63.
— Gottfried August Homilius — der bedeutendste Kreuzkantor des 18. Jahrhunderts (1755—1785),
[w:] Der Dresdner Kreuzchor, red. Dieter Härtwig, Matthias Herrmann, Leipzig 2006, s.
63-70.
Heuschneider, Karin, The Sonatas of C.S. Binder, [w:] eadem, The Piano Sonata of the Eighteenth
Century in Germany, Cape Town, Amsterdam 1970, s. 71—90.
Hochstein, Wolfgang, Die Dresdner Kapelle unter Johann AdolfHasse, [w:] Der Klang der Säch-
sischen Staatskapelle Dresden, red. Hans-Günter Ottenberg, Eberhard Steindorf, Hildes-
heim, Zürich, New York 2001, s. 81-94.
Koop, Christoph, Vorwort, [w:] Christlieb Siegmund Binder, Quatro A-Dur für 2 Violinen,
Cembalo und Violoncello, red. Christoph Koop, Beeskow 2006, s. V-VI.
Mattheson, Johann, Von der Musicalischen Tohne Eigenschafft und Würckung in Ausdrückung der
Ajfecten, [w:] idem, Das neu-eröffhete Orchestre, Hamburg 1713, s. 231—253.
Newman, William S., The Meaning of „Sonata”, [w:] idem, The Sonata in the Baroque Era, wyd.
zrewid. Chapel Hill [1966], s. 17-32.
— The Spread of the Baroque Sonata, [w:] idem, The Sonata in the Baroque Era, wyd. zrewid.
Chapel Hill [1966], s. 39-49.
— The Structure of the Baroque Sonata, [w:] idem, The Sonata in the Baroque Era, wyd. zrewid.
Chapel Hill [1966], s. 67-91.
— The Uses of the Sonata, [w:] idem, The Sonata in the Baroque Era, wyd. zrewid. Chapel Hill
[1966], s. 33-38.
Poppe, Gerhard, Instrumentalmusik am Dresdner Hof, [w:] Christlieb Siegmund Binder, Quatro
A-Dur fur 2 Violinen, Cembalo und Violoncello, red. Christoph Koop, Beeskow 2006, s. IV.
Schmid, Otto, [ Wstgp do Ausgewählte Original=Kompositionen Jur Klavier von Peter August
und Christlieb Siegmund Binder, red. Otto Schmid-Dresden, Leipzig, Brüssel, London,
New York 1943, s. [I-II].
Schnoor, Hans, An der Schwelle des Rokoko: Oper als Höhepunkt der Zwingerfeste, [w:] idem,
Dresden: vierhundert Jahre: deutsche Musikkultur: zum Jubiläum der Staatskapelle und zur
Geschichte der Dresdner Oper, Dresden [1948], s. 65—76.
— Dresdner Festoper — Spätblüte des Barocktheaters, [w:] idem: Dresden: vierhundert Jahre:
deutsche Musikkultur: zum Jubiläum der Staatskapelle und zur Geschichte der Dresdner Oper,
Dresden [1948], s. 85-95.
174
Bibliografía
—Johann Adolph Hasse hält Einzug in ein neues Dresden, [w:] idem, Dresden: vierhundert Jahre:
deutsche Musikkultur: zum Jubiläum der Staatskapelle und zur Geschichte der Dresdner Oper,
Dresden [1948], s. 77—84.
Steude, Wolfram; Landmann, Ortrun; Härtwig, Dieter, Höfische Musikpflege im 18. Jahrhun-
dert, [w:] eidem, Musikgeschichte Dresdens in Umrissen, Dresden 1978, s. 22-28.
Artykuty w czasopismach
Chodkowski, Andrzej, Teoria formy sonatowej Francesco Ga/eazziego i jej zastosowanie do ana-
lizy dziel Haydna i Mozarta, „Muzyka” 1991, nr 4, s. 69-76.
Engländer, Richard, Zur Dresdner Instrumentalmusik in der Zeit der Wiener Klassik, „Zeitschrift
fiir Musikwissenschaft”, Jg. 13: 1930, z. 1, s. 2-10.
Landmann, Ortrun, Marginalien zur Dresdener Höfischen Kammermusik zwischen 1720 und
1763, „Studien zur Auffiihrungspraxis und Interpretation von Instrumentalmusik des 18.
Jahrhunderts” 1984, z. 23, s. 11—18.
Poniatowska, Irena, OdMozarta do Chopina. O ekspozycji formy sonatowej mysli kilka, „Res Facta
Nova” 2008, nr 10, s. 175—188.
Zohn, Steven, Das Instrumentalrepertoire der Dresdner Hofkapelle in den ersten beiden Dritteln
des 18. Jahrhunderts: Überlieferung und Notisten,,, Eighteenth Century Music”, vol. 8:2011,
z. l,s. 168-170.
Hasla encyklopedyczne i stownikowe
Baumgartner, Alfred, Christlieb, Sigmund Binder (1723—89), [w:] Musik der Klassik, Salzburg
1982, s. 247-248.
Chodkowski, Andrzej, Binder, Christlieb Siegmund, [w:] Encyklopedia muzyczna PWM, cz$sc
biograficzna, [t. 1.]: ab, Krakow 1979, s. 321-322.
Churgin, Bathia, Galeazzi, Francesco, [w:] The New Grove Dictionary of Music and Musicians, t.
9: Florence to Gligo, II wyd., New York, London 2002, s. 433—434.
Dzi^bowska, Elzbieta, Koch, Heinrich Christoph, [w:] Encyklopedia muzyczna PWM, cz$sc bio-
graficzna, [t. 5.]: kll, Krakow 1997, s. 113-114.
Eitner, Robert, Binder, Christlieb (Christian) Sigmund, [w:] Biographisch-bibliographisches Quel-
len-Lexikon der Musiker und Musikgelehrten der christlichen Zeitrechnung bis zur Mitte des
neunzehnten Jahrhunderts, t. 2, Leipzig 1900, s. 46—47.
Härtwig, Dieter; Rosenmüller, Annegret, Binder, Christlieb Siegmund, [w:] The New Grove Dic-
tionary of Music and Musicians, t. 3: Baxter to Borosini, II wyd., New York, London 2002,
s. 593-594.
Negrey, Maciej, Rejcha, Antonín Josef [w:] Encyklopedia muzyczna PWM, cz^sc biograficzna, [t.
8.]: pe-r, Krakow 2004, s. 361—363.
Rosenmüller, Annegret; (Hausswald, Günter), Binder, Christlieb Siegmund, [w:] Die Musik
in Geschichte und Gegenwart (MGG), Personnenteil, t. 2: Bag—Bi, II wyd., Kassel, Basel,
London, New York, Prag 1999, szp. 1656-1657.
Steude, Wolfram; Landmann, Ortrun; Kremtz, Eberhard; Matthias, Herrmann, Dresden, [w:]
Die Musik in Geschichte und Gegenwart (MGG), Sachteil, t. 2: Böh-Enc, II wyd., Kassel,
Basel, London, New York, Prag 1995, szp. 1522-1545.
Sturm und Drang, [w:] Wielka encyklopedia powszechna PWN, [t.] 11: Ster-Urz, Warszawa
1968, s. 77.
Zörawska-Witkowska, Alina, Hasse, Johann Adolf [w:] Encyklopedia muzyczna PWM, cz^sc
biograficzna, [t. 4.]: hij, Krakow 1993, s. 90-99.
Bibiiografia
175
Prace niepublikowane
Gnyp, Joanna, Wczesne sonaty klawesynowe Christlieba Siegmunda Bindera —forma i faktura,
praca magisterska, maszynopis, Uniwersytet Warszawski 1986.
Poppe, Gerhard, e-mail do Pauliny Tkaczyk z dnia 19.02.2012 r. w posiadaniu autorki.
R^kopisy
[List Ch. S. Bindera do ksi^cia elektora saskiego, Drezno, 31 grudnia 1768]. „Acta: das Khur-
fiirst-Orchestre und deßen Unterhaltung ingleichen: das große Opern-Hauß und andere
zum Departement des Directeur des Plaisirs gehörige Angelegenheiten..Vol. 2: Anno
1769, Sächsisches Hauptstaatsarchiv Dresden, 10026 Geheimes Kabinett, Rps Loc.
910/2, k. 62-63.
[List Ch. S. Bindera do ksi^cia elektora saskiego, Drezno, 26 stycznia 1770]. „Acta: das Khur-
fiirst-Orchestre und deßen Unterhaltung ingleichen: das große Opern-Hauß und andere
zum Departement des Directeur des Plaisirs gehörige Angelegenheiten..Vbl. 2: Anno
1769, Sächsisches Hauptstaatsarchiv Dresden, 10026 Geheimes Kabinett, Rps Loc.
910/2, k. 194-195.
[List D. Bindermanna doTajnego Kolegium Finansowego, Drezno, 7 marca 1789]. „Acta: das
Khurfiirst-Orchestre und deßen Unterhaltung ingleichen: das große Opern-Hauß und
andere zum Departement des Directeur des Plaisirs gehörige Angelegenheiten...”, Vol.
10: Anno 1789, Sächsisches Hauptstaatsarchiv Dresden, 10026 Geheimes Kabinett, Rps
Loc. 911/1, k. 18.
[Rachunek z 29 wrzesnia 1778]. „Acta: das Khurfiirst-Orchestre und deßen Unterhaltung
ingleichen: das große Opern-Hauß und andere zum Departement des Directeur des
Plaisirs gehörige Angelegenheiten..Vol. 6: Anno 1778, Sächsisches Hauptstaatsarchiv
Dresden, 10026 Geheimes Kabinett, Rps Loc. 910/6, k. 78.
Wydawnictwa nutowe
Binder, Christlieb Sigimondo, Sei Suonateper il Cembalo, op. 1, Dresda [1759].
Binder, Christlieb Siegmund, Sei Sonateper clavicembalo, op. 1, Padova 2000.
Ryciny
Die Kapelle bei den Opern-Festauffuhrungen des Jahres 1719 (Ausschnitt), [w:] Hans
Schnoor,yf« der Schwelle des Rokoko: Oper als Höhepunkt der Zwingerfeste, [w:] idem, Dres-
den: vierhundert Jahre deutsche Musikkultur: zum Jubiläum der Staatskapelle und zur Ge-
schichte der Dresdner Oper, Dresden [1948], s. 68.
Dresda, Electoralis Saxoniae urbs, ad fluvium Albim sita, armamentario egregio et mirabili
Gazophylacio instructa, grafika,XVII w., Biblioteka Jagiellohska, zbiory graficzne 1.3706.
Dresden: Belvedere auf der Brühlschen Terrasse. Dresden: Naturzeichnung und Verlag v. F.
Müller. Druck v. J. Braunsdorf, Dresden, grafika, XIX w., Biblioteka Jagiellonska, zbiory
graficzne I. 5627.
Dressden [widok ogölny miasta], grafika, I cw. XVIII w., Biblioteka Jagiellonska, zbiory gra-
ficzne I. 23761, t. 358.
Dresden im Jahre 1749. Stich von Bernardo Belotto, gen. Canaletto, [w:] Hans Schnoor,/ö-
hann Adolph Hasse Hält Einzug in ein Neues Dresden, [w:] idem, Dresden: vierhundert Jahre
deutsche Musikkultur: zum Jubiläum der Staatskapelle und zur Geschichte der Dresdner Opery
Dresden [1948], s. 82.
176
Bibliografía
Mapy
Europa 1700-1721 [mapa], [w:] Jeremy Black, Europa XVIII wieku: 1700-1789, przel.
Jaroslaw Mikos, Warszawa 1997, s. [542].
Europa w latach 1763-1789 [mapa], [w:] Emanuel Rostworowski, Historiapowszechna: wiek
XVIII, wyd. VI, Warszawa 1998, s. pomi^dzy 592-593.
Geographische Delineation der Dioeces u. des Ammtes Dresden... edirt von M. Adam Fried-
rich Zürner, gestochen von Peter Schencken jun, [w:] Totius globi terraquei atlas continens
tabulas geographicas tarn generales quam speciales et precialissimas a diversis avtoribus editas,
[Amsterdam, przed r. 1742], t. II, Biblioteka Jagiellohska, zbiory kartograficzne, sygn. 11
V Atlasy.
Kursachsen um 1750 [mapa], [w:] Barock in Dresden: Kunst und Kunstsammlungen unter der
Regierung des Kurfirsten Friedrich August I. von Sachsen und Königs August II von Polen
genannt August der Starke 1694—1733 und des Kurßirsten Friedrich August II von Sachsen
und Königs August III. von Polen 1735—1763: eine Austeilung aus der Deutschen Demokrati-
schen Republik: in der Villa Hügel zu Essen vom 8. Juni bis 2. November 1986, Leipzig 1986,
s. 32-33.
Strony internetowe
Botelho, Jack, Dresden 1694-1763: Church and Municipal Music, [dokument elektroniczny:
http://www.bach-cantatas.com/Topics/Bachs-Time-2.htm, dostçp 21.10.2010].
Répertoire International des Sources Musicales (RISM) [katalog online: http://opac.rism.info/,
dostçp 10.05.2012].
„Schrank No: II”: Musik der Dresdner Hoßapelle: Die Instrumentalmusik zur Aeit der sächsisch-
polnischen Union, [dokument elektroniczny: http://www.schrank-zwei.de/willkommen/,
dostçp 10.05.2012].
Slomihska, Janina, Potçga stereotypu. A prof. Jackiem Staszewskim, historykiem, rozmawiaia Jani-
na Slominska, [rozmowa dnia 20.07.2010; dokument elektroniczny:
http://www.sprawynauki.edu.pl/index.php?option=com_content view-article id=1621 ca
tid=3178dtemid=30, dostçp 12.11.2010].
Materiaty fonograficzne
Bach, Abel’ Binder, [wyk.] Brigitte Haudebourg — pianoforte, Philippe Foulon — violoncello
damour, Paris 2004 [plyta CD + broszurka].
Binder, Christlieb Sigmund, Concerto per due cembali, [wyk.] Les Cyclopes, Bibiane Lapointe,
Thierry Maeder — clavecins et direction artistique, Paris 2004 [plyta CD + broszurka].
Indeks osöb
Abel, Carl Friedrich 29
Adam, Louis 66
Agricola, Johann Friedrich 37, 39, 67
Albicastro, Henricus 8
Anfossi, Pasquale 33
Augusta, Petera 42
August, Peter 37,41
Babbi, Cristoforo 31
Bach, Carl Philipp Emanuel 37, 44, 54,
63, 66, 67, 136,137, 138, 139,
144
Bach, Johann Christian 44
Bach, Johann Sebastian 36, 60, 66, 136,
148
Bach, Wilhelm Friedemann 44, 46,
138, 139
Balbastre, Claude-Bénigne 65
Banchieri, Adriano 59
Barrière, Jean 65
Bassemann, Johann Georg Adolph 37
Beauvarlet-Charpentier, Jean-Jacques
65
Beck, Johann Christoph 40, 42
Beethoven, Ludwig van 44,139
Beloselsky, ksi^zç rosyjski 37
Benda, Frantisek 44
Bernardi, Francesco 29
Bertoli, Giovanni Antonio 59
Besozzi, Antonio 29
Besozzi, Carlo 31
Bialko, Andrzej 10
Biber, Heinrich Johann Franz von 59
Binder, August Siegmund 52, 56
Binder, Carl Wilhelm Ferdinand 52
Binder, Dorothea Elizabeth 46
Binder, Johann Gottfried 46
Bindermann, D. 10, 53
Boccherini, Luigi 33
Böhme, Christian Gottlieb 40
Boismortier, Joseph Bodin de 65
Botelho, Jack 34, 35, 39
Breitkopf, Bernhard Christoph 40
Breunich, Johann Michael 33
Brossard, Sebastian de 60
Brühl, Heinrich 21, 37
Buffardin, Pierre-Gabriel 29
Buonamente, Giovanni Battista 60
Buono, Giovanni Pietro del 59
Burney, Charles 39, 47, 54, 66
Chale, Christian Friedrich 67
Christlieb, Theodor 35
Churgin, Bathia 69
Cima, Gian Paolo 59
Clément, Charles François 65
Conti, Franciszek 14
Corelli, Arcangelo 33, 64
178
Indeks osöb
Corneille, Pierre 14
Cornelius 33
Corrette, Michel 65
Couperin, Armand-Louis 65
Couperin, François 137
Dandrieu, Jean-François 137
Daquin, Louis-Claude 138
Dieupart, Charles 65
Dittersdorf, Karl Ditters von 44
Dotzauer, Johann Friedrich 31
Duphly, Jacques 65
Duschek [Dusik, Dussek], Jan Ladislav
42
Dziçbowska, Elzbieta 68
Edler, Arnfried 62, 63, 65, 66, 67, 68
Engländer, Richard 38, 39, 45, 54
Erlauchten, Fleinrich den 35
Esterhazy, Miklös Jözsef 44
Fanfani, Giuseppe Maria 8
Fantini, Girolamo 59
Fasch, Carl 67
Fasch, Johann Friedrich 8
Feicht, Hieronim 25, 26, 27, 34
Fischer, Johann Christian 31
Fischietti, Domenico 30, 33
Fleischer, Heinrich 32,40, 46, 47,48,
53, 54, 56, 140, 151
Forkel, Johann Nikolaus 39, 53, 54, 67
Fryderyk August I [August II Mocny]
11, 12, 14, 18,21,25, 26, 27, 32,
34, 47
Fryderyk August II [August III] 11,12,
17, 18,21,22,24,30,32,46,47
Fryderyk August III 9, 11, 22, 24, 31,
32, 38, 39, 40, 41, 43, 44, 45, 48,
50
Fryderyk Chrystian 11, 22, 30
Fryderyk I Wielki, kröl Prus 30
Fürstenau, Moritz 26, 27
Gabrielli, Domenico 59
Galeazzi, Francesco 68, 69
Galuppi, Baldassare 64, 137, 144
Geek, Karl Wilhelm 8
Geminiani, Francesco Xaverio 8, 33
Gerber, Ernst Ludwig 39, 47, 53
Goethe, Johann Wolfgang 138
Gorzanis, Giacomo 61
Gottfried, Carl 31
Gotzel, Franz Joseph 31
Gould, Glenn 70
Grabner, rodzina budowniezyeh
imstrumentow 39
Graun, Carl Heinrich 8, 37, 44
Graun, Johann Gottlieb 8
Grenser, rodzina budowniezyeh
imstrumentow 39
Grundmann, Jacob Friedrich 39
Gruner, Nathanael Gottfried 42
Guerres, Elizabeth Jacquet de la 65
Guillemain, Louis-Gabriel 65
Händel, Georg Friedrich 8,29, 33
Härtwig, Dieter 22, 34, 35, 36, 37
Hasse-Bordoni, Faustina 29
Hasse, Johann Adolf 14, 18, 19, 29, 30,
33, 36, 52, 64
Hässler, Johann Wilhelm 44
Haudeck, Carl Johann 31
Haußstädtler, Johann Gottlieb 42, 45
Hausswald, Günter 56
Haydn, Joseph 8, 33, 44, 66, 139
Hebenstreit, Pantaleon 29, 32,46, 47,
50
Heinichen, Johann David 18, 26, 29,
33, 39
Heller, Karl 8
Herrmann, Matthias 34
Hertel, Johann Wilhelm 67
Heyne, Gottfried 36
Hildebrandt, Zacharias 39
Hiller, Johann Adam 39, 54
Hoffmeister, Franz Anton 44
Hofmann, Eberhard 56, 57
Indeks osöb
179
Homilius, Gottfried August 9, 36, 37,138
Horn, bracia, budowniczy instrumen-
töw 39
Hunt, Franz 31
Izrael (Binder), Eleonore Sophie 48
Jan Jerzy III Wettyn 14
Karol Albert, elektor bawarski 22
Karol, brat Fryderyka Augusta III 21
Karol VI, cesarz Austrii 17
Karol XII, kröl Szwecji 12
Kindermann, Johann Erasmus 62
Klinger, Friedrich Maximilian 138
Knuth 37
Koch, Heinrich Christoph 63, 68, 69
Konopczyhski, Wtadyslaw 12, 21
Koop, Christoph 48
Kozeluch, Jan Antonín 44
Kremmler, Johann George 40
Kremtz, Eberhard 18, 26, 29, 32, 34, 35,
36, 38, 39
Kress, Johann Jakob 8
Ksawery, brat Fryderyka Augusta III
11,21,22, 30
Kuhnau, Johann 64
Kummer, Gotthelf Heinrich 31
Kunzen, Adolph Carl 67
Landmann, Ortrun 18,22,26,29,30,
31,32, 34, 35, 36, 37, 38, 39
Lange 42
Lapointe, Bibiane 44, 54
Leszczyhski, Stanislaw, kröl Polski 12,
17
Listing, Johann Christian Gottlob 31
Locatelli, Giovanni Battista 37
Loeillet, Jean-Baptist 59
Löhlein, Georg Simon 42,44
Lotti, Antonio 18, 29
Lotti, Santa Stella 29
Löwenhjelm 37
Lucchesi, Andrea 33
Ludwik XIV, kröl Francji 46
Maeder, Thierry 7, 44, 54
Maria Antonia, elektorowa saska 71
Maria Jözefa, zona Fryderyka Augusta
II 17,30
Marini, Biagio 60, 62
Marpurg, Friedrich Wilhelm 67
Marx, Adolf Bernhard 69,70
Mattheson, Johann 59, 60, 61, 149, 150
Matthias, Hermann 18, 26, 29, 32, 34,
35, 36, 38, 39
M^dry, Alina 69, 137, 138, 144, 148
Mehul, Etienne-Nicolas 66
Mensel, Johann Georg 40, 53, 54
Mingotti, Angelo 39
Mingotti, Pietro 39
Molier (Jean Baptiste Poquelin) 14
Mondonville, Jean-Joseph de 65
Moretti, Pietro 31
Morgenroth, Franz Anton 31
Mozart, Wolfgang Amadeus 38, 44,
139
Müthel, Johann Gottfried 141, 142
Naumann, Johann Gottlieb 30,31,33,
36, 37, 38, 44, 52
Neefe, Christian Gottlob 67
Negrey, Maciej 69
Neruda, Johann Baptist Georg 42
Newman, William S. 59, 60
Nichelmann, Christoph 42, 44, 67, 144
Noelli, Georg 46
Ottenberg, Hans-Günter 27
Pachelbel, Johann 59
Paer, Ferdinando 31
180
ïndeks osôb
Paganelli, Giuseppe Antonio 64
Paradisi, Pietro-Domenico 64
Pasquini, Bernardo 62
Perandy, Marco Giuseppe 36
Pergolesi, Giovanni Battista 137
Pescetti, Giovanni-Battista 64
Pioutatine, ksi^zç rosyjski 37
Pisendel, Johann Georg 8, 29, 30, 33
Pleyel, Ignaz Joseph 44, 66
Pohland, Franz 31
Polledro, Giovanni Battista 31
Poniatowska, Irena 69
Poppe, Gerhard 8, 54, 55
Praetorius, Michael 60
Prinz, Johann Friedrich 31
Puffiioldt, Erdmann 36
Quantz, Johann Joachim 27, 29, 39,
137, 138
Racine, Jean Baptiste 14
Rafael (Raffaello Santi) 21
Rameau, Jean-Philippe 137,138
Reicha, Antonín 69
Reichardt, Johann Friedrich 39, 44
Reinhold, Theodor Christlieb 35, 36, 37
Richter, Johann Christoph 32, 47
Ristori, Giovanni Alberto 26, 29, 30,
33,36
Röllig, Karl Leopold 44
Rosenmüller, Annegret 40, 44,45, 55,
56,57,152
Rostworowski, Emanuel 12,21
Rothe, brada, klarnecisci 31
Rözycki, Jacek 27
Sammartini, Giovanni Battista 64
Sarti, Giuseppe 33, 64
Scarlatti, Domenico 65
SchafFrath, Christoph 67
Scheibe, Johann Adolph 60, 61
Schenk, Johannes 59
Schiller, Johann 138
Schmid, Otto 41, 152
Schmidt, Johann Christoph 26, 27, 32
Schnauke, Gottfried Heinrich 36
Schneider, Conrad Michael 66
Schobert, Johann 44
Schönberg, hrabia 37
Schröter, Christoph Gottlieb 39
Schubert, Joseph 31
Schulz, Johann Abraham Peter 66
Schürer, Johann Georg 30, 33
Schuster, Joseph 9, 30, 33, 36, 37, 41
Schütz, Heinrich 11,30,36
Sejan, Nicolas 65
Seydelmann, Franz 30, 33, 36
Seyler, Abel 31,38
Silbermann, Gottfried 39, 54
Speer, Daniel 60
Stamitz, Jan Vaclav Antonín 44
Staszewski, Jacek 11, 14, 18, 21, 24, 25,
26, 27, 32, 44
Steindorf, Eberhard 27
Sterkel, Johann Franz Xaver 44
Steude, Wolfram 18,22,26,29,32,34,
35, 36, 38, 39
Strözynska, Beata 25, 40, 41, 55, 57, 149
Szwedowska, Jadwiga 18
Telemann, Georg Philipp 8, 33
Tosi, Pier Francesco 39
Tricklir, Jean Balthasar 31
Türk, Daniel Gottlob 63
Vanhal, Jan Krtitel 33, 44
Veracini, Francesco Maria 18,29
Vivaldi, Antonio 8, 33
Vogler, Georg Joseph 63
Voîumier, Jean-Baptiste 29
Wagenseil, Georg Christoph 44
Wagner, Christian Salomon 39
Indeks osöb
181
Wagner, Johann Gottlob 39
Walpurgis, Maria Antonia 22, 43
Walther, Johann Gottfried 60, 61
Weber, Constantin Joseph 47
Weber, Daniel 36
Weiss, Silvius Leopold 29
Weiß, Johann Paul 36
Wollny, Peter 8
Zelenka, Jan Dismas 29, 30, 33
Zofia z d. Hohenzollern, elektorowa,
zona Krystiana I Wettyna 35
Zörawska-Witkowska, Alina 25, 26, 27,
32, 34, 47
Streszczenie
Podstawowym przedmiotem rozwazari pracy zatytulowanej Stylistyczna
röznorodnosc *w twörczosci Christlieba Siegmunda Bindera na przykladzie
zbioru Sonat klawesynowych op. 1 - migdzy barokiem a klasycyzmem s^. So-
naty klawesynowe op. 1 Christlieba Siegmunda Bindera, wydane drukiem
w 1759 roku.To bardzo oryginalne i ciekawe kompozycje, z jednej strony
si^gaj^ce epoki baroku,z drugiej,ukazuj^ce juzform? sonaty klasycznej. Ce-
lem pracy bylo zaprezentowanie fenomenu artystycznego zapomnianego
przez minione dwiescie lat drezdenskiego kompozytora. O zyciu i dzialal-
nosci artystycznej tego twörcy wiadomosci jest stosunkowo niewiele. Fakt
ten zrodzil potrzeb^ poznania dziel kompozytora, a fascynacja autorki
pracy muzycznym swiatem stworzonym przez Bindera pogl^bila pragnie-
nie pelniejszego poznania tej literatury. Szczegölowa analiza zbioru Sonat
klawesynowych op. 1 ukazata ich niezwykle harmoniczne i emocjonalne
bogactwo. Rozwazania szczegölowo ilustrowane przykladami muzycz-
nymi, a przedstawienie zbioru sonat w formie syntetycznej analizy tabela-
rycznej przebiegu muzycznego jeszcze bardziej wyraziscie ukazuje cechy
stylistyczne utworöw. Ich röznorodnosc pozwolila zaprezentowac przeni-
kanie si? röznych stylöw wraz z narodzinami nowej estetyki muzycznej.
Ch. S. Binder byl artyst^. dynamicznym, l^czyl w swej twörczosci wie-
le kierunköw i stylöw, znacznie przyczynil si$ do rozwoju muzyki instru-
mentalnej. Praca dowiodla, ze warto si^gac do dziel z bogatego dorobku
kompozytora, gdyz stanowiij one wyj^tkowe zjawisko w historii muzyki.
Poniewaz zycie muzyczne Drezna w XVIII wieku i tworz^cych tu
kompozytoröw nie doczekalo si$ jeszcze caiosciowego opracowania, zas
186
Streszczenie
w j^zyku polskim literatura na ten temat jest bardzo nieliczna, dlatego
przedstawiona w publikacji problematyka historyczno-kulturalna Drezna
jest bardzo zasadna. Poruszone mi^dzy innymi zagadnienia prezentu-
j^ce muzyk^ na dworze Sasów, przyblizona jest dzialalnosc drezdeñskiej
kapeli i innych muzycznych zespotów, obok dworskiej, omówiona jest
muzyka koscielna i miejska.
W pracy zastosowane zostaly trzy wspieraj^ce si$ metody: historycz-
na, analityczna i porównawcza.
Calóse stanowi znaezny wklad autorki w rozwój dyscypliny artystyez-
nej instrumentalistyka.
Slowa kluezowe:
Kompozytor niemiecki — 18. wiek; Sonaty klawesynowe; Sonata na in-
strumenty klawiszowe - 18. wiek; Muzyka - Drezno - 18. wiek; Forma
sonatowa; Drezno - historia — kultura - muzyka — 18. wiek; Dwór saski
- muzyka; Kapela drezdeñska - historia
Summary
The primary focus of the thesis entitled Stylistic Diversity in Christlieb
Siegmund Binders Works as Exemplified by the Collection of Harpsichord So-
natas Op. 1: Between the Baroque and Classical Periods are Christlieb Sieg-
mund Binders Harpsichord Sonatas Op. 1, published in 1759. These highly
original and interesting compositions draw on the baroque period on the
one hand, while displaying the formal features of classical sonata on the
other. The aim of the thesis was to present the artistic phenomenon of
the Dresden composer, who has been forgotten for the last two hundred
years. Fairly little is known about the life and artistic activity of the com-
poser. This fact gave rise to a desire to familiarise oneself with Binder’s
works, while the writer s fascination with the musical world created by the
composer intensified the desire to learn about the works more fully. The
detailed analysis of the collection of Harpsichord Sonatas Op. 1 revealed
their exceptional harmonic and emotional abundance.The thesis, illustrat-
ed by musical examples and including the presentation of the collection in
the form of summative tabular analysis of the musical passage, allows to
display the stylistic characteristics of the works even more sharply. Their
diversity allowed to present the overlapping of various styles and the rise
of new musical aesthetics.
Ch. S. Binder was a dynamic artist who combined many different
trends and styles in his works and who largely contributed to the deve-
lopment of instrumental music. The thesis proved that it is worth turning
to the compositions from the composer’s rich body of work, as they con-
stitute a unique phenomenon in the history of music.
190
Summary
Since the musical life of the 18th century Dresden and its composers
has not been comprehensively examined to date and the Polish sources
on the topic are very scarce, the historical and cultural aspects of Dresden
presented in the publication are very well-grounded. The thesis, among
other topics, discusses the problem of music at the Saxon court, the activi-
ty of the Dresden court chapel and other musical ensembles. Beside court
music, church and town music are discussed as well.
The thesis makes use of three mutually supportive methods: the his-
torical, the analytic and the comparative one.
The work constitutes the writer’s considerable contribution to the de-
velopment of the artistic field of instrumental performance.
Keywords:
German composer — 18th c.; Harpsichord sonatas; Keyboard sonatas -
18th c.; Music - Dresden - 18th c.; Sonata form; Dresden - history — cul-
ture — music — 18th c.; Saxon court - music; Dresden chapel - history
|
| any_adam_object | 1 |
| author | Tkaczyk, Paulina |
| author_GND | (DE-588)1151236713 |
| author_facet | Tkaczyk, Paulina |
| author_role | aut |
| author_sort | Tkaczyk, Paulina |
| author_variant | p t pt |
| building | Verbundindex |
| bvnumber | BV044752963 |
| ctrlnum | (OCoLC)1045359247 (DE-599)BVBBV044752963 |
| format | Book |
| fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>03277nam a2200433 c 4500</leader><controlfield tag="001">BV044752963</controlfield><controlfield tag="003">DE-604</controlfield><controlfield tag="005">20181212 </controlfield><controlfield tag="007">t|</controlfield><controlfield tag="008">180208s2017 xx agl| |||| 00||| pol d</controlfield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9788370992156</subfield><subfield code="9">978-83-7099-215-6</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)1045359247</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-599)BVBBV044752963</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-604</subfield><subfield code="b">ger</subfield><subfield code="e">rda</subfield></datafield><datafield tag="041" ind1="0" ind2=" "><subfield code="a">pol</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-12</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">MUS</subfield><subfield code="q">DE-12</subfield><subfield code="2">fid</subfield></datafield><datafield tag="100" ind1="1" ind2=" "><subfield code="a">Tkaczyk, Paulina</subfield><subfield code="e">Verfasser</subfield><subfield code="0">(DE-588)1151236713</subfield><subfield code="4">aut</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Stylistyczna różnorodność w twórczości Christlieba Siegmunda Bindera</subfield><subfield code="b">na przykładzie zbioru Sonat klawesynowych op. 1 – między barokiem a klasycyzmem = Stylistic diversity in Christlieb Siegmund Binder's works as exemplified by the Collection of Harpsichord Sonatas Op. 1 : between the Baroque and Classical Periods = Stilistische Vielfalt in dem Werk von Christlieb Siegmund Binder am Beispiel der Sonatensammlung für Cembalo op. 1 : zwischen Barock und Klassizismus</subfield><subfield code="c">Paulina Tkaczyk</subfield></datafield><datafield tag="246" ind1="1" ind2="1"><subfield code="a">Stylistic diversity in Christlieb Siegmund Binder's works as exemplified by the Collection of Harpsichord Sonatas Op. 1</subfield></datafield><datafield tag="246" ind1="1" ind2="1"><subfield code="a">Stilistische Vielfalt in dem Werk von Christlieb Siegmund Binder am Beispiel der Sonatensammlung für Cembalo op. 1</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">Kraków</subfield><subfield code="b">Musica Iagellonica</subfield><subfield code="c">2017</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">190 Seiten</subfield><subfield code="b">Illustrationen, Diagramme, Notenbeispiele</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="b">n</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="b">nc</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="546" ind1=" " ind2=" "><subfield code="a">Zusammenfassung in Englisch und Deutsch</subfield></datafield><datafield tag="600" ind1="1" ind2="7"><subfield code="a">Binder, Christlieb Siegmund</subfield><subfield code="d">1723-1789</subfield><subfield code="0">(DE-588)122849108</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="689" ind1="0" ind2="0"><subfield code="a">Binder, Christlieb Siegmund</subfield><subfield code="d">1723-1789</subfield><subfield code="0">(DE-588)122849108</subfield><subfield code="D">p</subfield></datafield><datafield tag="689" ind1="0" ind2=" "><subfield code="5">DE-604</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">Digitalisierung BSB München 19 - ADAM Catalogue Enrichment</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=030148571&sequence=000006&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Inhaltsverzeichnis</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">Digitalisierung BSB München 19 - ADAM Catalogue Enrichment</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=030148571&sequence=000007&line_number=0002&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Literaturverzeichnis</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">Digitalisierung BSB München 19 - ADAM Catalogue Enrichment</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=030148571&sequence=000008&line_number=0003&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Register // Personenregister</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">Digitalisierung BSB München 19 - ADAM Catalogue Enrichment</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=030148571&sequence=000009&line_number=0004&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Abstract</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">Digitalisierung BSB München 19 - ADAM Catalogue Enrichment</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=030148571&sequence=000010&line_number=0005&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Abstract</subfield></datafield><datafield tag="940" ind1="1" ind2=" "><subfield code="n">oe</subfield></datafield><datafield tag="942" ind1="1" ind2="1"><subfield code="c">780.9</subfield><subfield code="e">22/bsb</subfield><subfield code="f">09033</subfield><subfield code="g">438</subfield></datafield><datafield tag="942" ind1="1" ind2="1"><subfield code="c">780.9</subfield><subfield code="e">22/bsb</subfield><subfield code="f">09033</subfield><subfield code="g">43</subfield></datafield><datafield tag="943" ind1="1" ind2=" "><subfield code="a">oai:aleph.bib-bvb.de:BVB01-030148571</subfield></datafield></record></collection> |
| id | DE-604.BV044752963 |
| illustrated | Illustrated |
| indexdate | 2024-12-20T18:10:45Z |
| institution | BVB |
| isbn | 9788370992156 |
| language | Polish |
| oai_aleph_id | oai:aleph.bib-bvb.de:BVB01-030148571 |
| oclc_num | 1045359247 |
| open_access_boolean | |
| owner | DE-12 |
| owner_facet | DE-12 |
| physical | 190 Seiten Illustrationen, Diagramme, Notenbeispiele |
| publishDate | 2017 |
| publishDateSearch | 2017 |
| publishDateSort | 2017 |
| publisher | Musica Iagellonica |
| record_format | marc |
| spellingShingle | Tkaczyk, Paulina Stylistyczna różnorodność w twórczości Christlieba Siegmunda Bindera na przykładzie zbioru Sonat klawesynowych op. 1 – między barokiem a klasycyzmem = Stylistic diversity in Christlieb Siegmund Binder's works as exemplified by the Collection of Harpsichord Sonatas Op. 1 : between the Baroque and Classical Periods = Stilistische Vielfalt in dem Werk von Christlieb Siegmund Binder am Beispiel der Sonatensammlung für Cembalo op. 1 : zwischen Barock und Klassizismus Binder, Christlieb Siegmund 1723-1789 (DE-588)122849108 gnd |
| subject_GND | (DE-588)122849108 |
| title | Stylistyczna różnorodność w twórczości Christlieba Siegmunda Bindera na przykładzie zbioru Sonat klawesynowych op. 1 – między barokiem a klasycyzmem = Stylistic diversity in Christlieb Siegmund Binder's works as exemplified by the Collection of Harpsichord Sonatas Op. 1 : between the Baroque and Classical Periods = Stilistische Vielfalt in dem Werk von Christlieb Siegmund Binder am Beispiel der Sonatensammlung für Cembalo op. 1 : zwischen Barock und Klassizismus |
| title_alt | Stylistic diversity in Christlieb Siegmund Binder's works as exemplified by the Collection of Harpsichord Sonatas Op. 1 Stilistische Vielfalt in dem Werk von Christlieb Siegmund Binder am Beispiel der Sonatensammlung für Cembalo op. 1 |
| title_auth | Stylistyczna różnorodność w twórczości Christlieba Siegmunda Bindera na przykładzie zbioru Sonat klawesynowych op. 1 – między barokiem a klasycyzmem = Stylistic diversity in Christlieb Siegmund Binder's works as exemplified by the Collection of Harpsichord Sonatas Op. 1 : between the Baroque and Classical Periods = Stilistische Vielfalt in dem Werk von Christlieb Siegmund Binder am Beispiel der Sonatensammlung für Cembalo op. 1 : zwischen Barock und Klassizismus |
| title_exact_search | Stylistyczna różnorodność w twórczości Christlieba Siegmunda Bindera na przykładzie zbioru Sonat klawesynowych op. 1 – między barokiem a klasycyzmem = Stylistic diversity in Christlieb Siegmund Binder's works as exemplified by the Collection of Harpsichord Sonatas Op. 1 : between the Baroque and Classical Periods = Stilistische Vielfalt in dem Werk von Christlieb Siegmund Binder am Beispiel der Sonatensammlung für Cembalo op. 1 : zwischen Barock und Klassizismus |
| title_full | Stylistyczna różnorodność w twórczości Christlieba Siegmunda Bindera na przykładzie zbioru Sonat klawesynowych op. 1 – między barokiem a klasycyzmem = Stylistic diversity in Christlieb Siegmund Binder's works as exemplified by the Collection of Harpsichord Sonatas Op. 1 : between the Baroque and Classical Periods = Stilistische Vielfalt in dem Werk von Christlieb Siegmund Binder am Beispiel der Sonatensammlung für Cembalo op. 1 : zwischen Barock und Klassizismus Paulina Tkaczyk |
| title_fullStr | Stylistyczna różnorodność w twórczości Christlieba Siegmunda Bindera na przykładzie zbioru Sonat klawesynowych op. 1 – między barokiem a klasycyzmem = Stylistic diversity in Christlieb Siegmund Binder's works as exemplified by the Collection of Harpsichord Sonatas Op. 1 : between the Baroque and Classical Periods = Stilistische Vielfalt in dem Werk von Christlieb Siegmund Binder am Beispiel der Sonatensammlung für Cembalo op. 1 : zwischen Barock und Klassizismus Paulina Tkaczyk |
| title_full_unstemmed | Stylistyczna różnorodność w twórczości Christlieba Siegmunda Bindera na przykładzie zbioru Sonat klawesynowych op. 1 – między barokiem a klasycyzmem = Stylistic diversity in Christlieb Siegmund Binder's works as exemplified by the Collection of Harpsichord Sonatas Op. 1 : between the Baroque and Classical Periods = Stilistische Vielfalt in dem Werk von Christlieb Siegmund Binder am Beispiel der Sonatensammlung für Cembalo op. 1 : zwischen Barock und Klassizismus Paulina Tkaczyk |
| title_short | Stylistyczna różnorodność w twórczości Christlieba Siegmunda Bindera |
| title_sort | stylistyczna roznorodnosc w tworczosci christlieba siegmunda bindera na przykladzie zbioru sonat klawesynowych op 1 miedzy barokiem a klasycyzmem stylistic diversity in christlieb siegmund binder s works as exemplified by the collection of harpsichord sonatas op 1 between the baroque and classical periods stilistische vielfalt in dem werk von christlieb siegmund binder am beispiel der sonatensammlung fur cembalo op 1 zwischen barock und klassizismus |
| title_sub | na przykładzie zbioru Sonat klawesynowych op. 1 – między barokiem a klasycyzmem = Stylistic diversity in Christlieb Siegmund Binder's works as exemplified by the Collection of Harpsichord Sonatas Op. 1 : between the Baroque and Classical Periods = Stilistische Vielfalt in dem Werk von Christlieb Siegmund Binder am Beispiel der Sonatensammlung für Cembalo op. 1 : zwischen Barock und Klassizismus |
| topic | Binder, Christlieb Siegmund 1723-1789 (DE-588)122849108 gnd |
| topic_facet | Binder, Christlieb Siegmund 1723-1789 |
| url | http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=030148571&sequence=000006&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=030148571&sequence=000007&line_number=0002&func_code=DB_RECORDS&service_type=MEDIA http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=030148571&sequence=000008&line_number=0003&func_code=DB_RECORDS&service_type=MEDIA http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=030148571&sequence=000009&line_number=0004&func_code=DB_RECORDS&service_type=MEDIA http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=030148571&sequence=000010&line_number=0005&func_code=DB_RECORDS&service_type=MEDIA |
| work_keys_str_mv | AT tkaczykpaulina stylistycznaroznorodnoscwtworczoscichristliebasiegmundabinderanaprzykładziezbiorusonatklawesynowychop1miedzybarokiemaklasycyzmemstylisticdiversityinchristliebsiegmundbindersworksasexemplifiedbythecollectionofharpsichordsonatasop1betweenthebaroqueandclassi AT tkaczykpaulina stylisticdiversityinchristliebsiegmundbindersworksasexemplifiedbythecollectionofharpsichordsonatasop1 AT tkaczykpaulina stilistischevielfaltindemwerkvonchristliebsiegmundbinderambeispieldersonatensammlungfurcembaloop1 |