Selected proceedings of the eighth International Conference on Waste Management and Technology: selected, peer reviewed papers from the eighth International Conference on Waste Management and Technology (ICWMT 8), October 23-25, 2013, Shanghai, China
Gespeichert in:
Weitere beteiligte Personen: | , |
---|---|
Format: | Elektronisch E-Book |
Sprache: | Englisch |
Veröffentlicht: |
Zurich, Switzerland
Trans Tech Publications
[2014]
|
Schriftenreihe: | Advanced materials research
v. 878 |
Schlagwörter: | |
Links: | http://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=696651 http://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=696651 |
Beschreibung: | "Towards ecological civilization"--Cover Online resource; title from PDF title page (ebrary, viewed March 20, 2014) |
Umfang: | 1 online resource (926 pages) illustrations (some color), graphs, photographs |
ISBN: | 9783038263630 303826363X 9783037859827 |
Internformat
MARC
LEADER | 00000nam a2200000zcb4500 | ||
---|---|---|---|
001 | BV043780900 | ||
003 | DE-604 | ||
005 | 00000000000000.0 | ||
007 | cr|uuu---uuuuu | ||
008 | 160920s2014 xx ao|| o|||| 00||| eng d | ||
020 | |a 9783038263630 |9 978-3-03826-363-0 | ||
020 | |a 303826363X |9 3-03826-363-X | ||
020 | |a 9783037859827 |9 978-3-03785-982-7 | ||
035 | |a (ZDB-4-EBA)ocn878138233 | ||
035 | |a (OCoLC)878138233 | ||
035 | |a (DE-599)BVBBV043780900 | ||
040 | |a DE-604 |b ger |e rda | ||
041 | 0 | |a eng | |
049 | |a DE-1046 |a DE-1047 | ||
082 | 0 | |a 628.445 |2 23 | |
245 | 1 | 0 | |a Selected proceedings of the eighth International Conference on Waste Management and Technology |b selected, peer reviewed papers from the eighth International Conference on Waste Management and Technology (ICWMT 8), October 23-25, 2013, Shanghai, China |c edited by Jinhui Li and Hualong Hu |
264 | 1 | |a Zurich, Switzerland |b Trans Tech Publications |c [2014] | |
264 | 4 | |c © 2014 | |
300 | |a 1 online resource (926 pages) |b illustrations (some color), graphs, photographs | ||
336 | |b txt |2 rdacontent | ||
337 | |b c |2 rdamedia | ||
338 | |b cr |2 rdacarrier | ||
490 | 0 | |a Advanced materials research |v v. 878 | |
500 | |a "Towards ecological civilization"--Cover | ||
500 | |a Online resource; title from PDF title page (ebrary, viewed March 20, 2014) | ||
505 | 8 | |a Selected Proceedings of the Eighth International Conference on Waste Management and Technology; Preface and Editorial Board; Table of Contents; Chapter 1: Circular Economy and Urban Mining; Towards Integrated Municipal Solid Waste Management: A Case of Urumqi, China; Import & Export Management for Waste Raw Materials between China and Japan; Municipal Solid Waste Management Practice in China -- A Case Study in Hangzhou; Substance Flow Analysis of Lead for Sustainable Resource Management and Pollution Control; Transfer Regularity of Fe(III)-Al(III) in the Extraction of Indium from Waste TFT-LCD. | |
505 | 8 | |a Positive and Negative Impacts of Carbon Taxes in China: A Cost-Benefit PerspectiveChemical and Mineralogical Characterizations of Cobalt Precursor Recovered from Spent Lithium-Ion Batteries with Incineration Process; A Life-Cycle Based Approach to the Remanufacturing Printing Supplies in Shanghai; Literature Review and Prospect on the End-of-Life Vehicles Reverse Logistics; The Decision on Reserve Logistics Network Structure of End-of-Life Vehicles Recycling; Composition Determination of Vehicle Dismantling Waste; Comparison Study of Scrap Tires Management between China and the USA. | |
505 | 8 | |a Possibility of BFRs Extraction from E-WasteWood-Plastic Composites Prepared by Waste Polypropylene and Toughening; Metals Contamination and Leaching Potential in Plastic Toys Bought on the Beijing Market; Current Status of Fiber Waste Recycling and its Future; Study on Special Recycling of PVC Plastics Promoted by School Students in Tianjin; Biomethane by Psychrophilic Methanogenic Community Isolated from Sediment of Crane Lake in Zhalong Wetland, Northeast China; Chapter 2: Industrial Waste; Efficient Extraction of SiO2 and Al2O3 from Coal Gangue by Means of Acidic Leaching | |
505 | 8 | |a Development of Tailings Based Polymer-Modified Waterproof MortarThe Process and Mechanism of Electrolytic Manganese Anode Slime Lead Removal; Mechanical Properties and Microstructure Analysis of Copper Tailings Solidifying with Different Cementitious Materials; Co-Pyrolysis Characteristics and Product Distributions of Coal Tailings and Biomass Blends; Enhanced Chromium Recovery from Tannery Waste by Acid-Alkali Reaction in China; Autoclaved Brick from Steel Slag and Silicon Tailings; Characterization of a Sorbent Derived from Construction and Demolition Waste | |
505 | 8 | |a Comparing Analysis on the Way of Tailings Disposal in China and AustraliaDischarge and Disposal of Coal Gasification Methanol Production Residue and Distribution Characteristics of PAHs in it; Assessing the Life Cycle Environmental and Economic Performance of Copper Slag Recycling; Removal of Phenol from Aqueous Solutions by Adsorption onto Amine-Modified Fly Ash Cenospheres (FACs); Experimental Study on Comprehensive Recovery of Valuable Minerals from Flotation Tailings in Copper-Molybdenum Mine; Enhanced Steelmaking Slag Mineral Carbonation in Dilute Alkali Solution | |
505 | 8 | |a With the development of industry and the improvement of living standards, the amount of solid waste is increasing rapidly. New research and industries solutions in the field of waste management and recycling become increasingly important. The volume highlights the academic and policy trends on waste management and collects the latest research trends and innovative ideas in the solid waste field. The peer reviewed papers are grouped as follows: Chapter 1. Circular Economy and Urban Mining; Chapter 2. Industrial Waste; Chapter 3. Electrical and Electronic Waste; Chapter 4. Biomass Energy; Chapte | |
650 | 7 | |a TECHNOLOGY & ENGINEERING / Environmental / General |2 bisacsh | |
650 | 7 | |a Recycling (Waste, etc.) |2 fast | |
650 | 7 | |a Refuse and refuse disposal |2 fast | |
650 | 7 | |a Waste disposal sites / Environmental aspects |2 fast | |
650 | 7 | |a Waste minimization |2 fast | |
650 | 4 | |a Umwelt | |
650 | 4 | |a Refuse and refuse disposal |v Congresses |a Recycling (Waste, etc.) |v Congresses |a Waste minimization |v Congresses |a Waste disposal sites |x Environmental aspects |v Congresses | |
655 | 7 | |0 (DE-588)1071861417 |a Konferenzschrift |2 gnd-content | |
700 | 1 | |a Li, Jinhui |4 edt | |
700 | 1 | |a Hu, Hualong |4 edt | |
776 | 0 | 8 | |i Erscheint auch als |n Druck-Ausgabe |a Selected proceedings of the eighth International Conference on Waste Management and Technology : selected, peer reviewed papers from the eighth International Conference on Waste Management and Technology (ICWMT 8), October 23-25, 2013, Shanghai, China |
912 | |a ZDB-4-EBA | ||
943 | 1 | |a oai:aleph.bib-bvb.de:BVB01-029191960 | |
966 | e | |u http://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=696651 |l DE-1046 |p ZDB-4-EBA |q FAW_PDA_EBA |x Aggregator |3 Volltext | |
966 | e | |u http://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=696651 |l DE-1047 |p ZDB-4-EBA |q FAW_PDA_EBA |x Aggregator |3 Volltext |
Datensatz im Suchindex
_version_ | 1818982300945219584 |
---|---|
any_adam_object | |
author2 | Li, Jinhui Hu, Hualong |
author2_role | edt edt |
author2_variant | j l jl h h hh |
author_facet | Li, Jinhui Hu, Hualong |
building | Verbundindex |
bvnumber | BV043780900 |
collection | ZDB-4-EBA |
contents | Selected Proceedings of the Eighth International Conference on Waste Management and Technology; Preface and Editorial Board; Table of Contents; Chapter 1: Circular Economy and Urban Mining; Towards Integrated Municipal Solid Waste Management: A Case of Urumqi, China; Import & Export Management for Waste Raw Materials between China and Japan; Municipal Solid Waste Management Practice in China -- A Case Study in Hangzhou; Substance Flow Analysis of Lead for Sustainable Resource Management and Pollution Control; Transfer Regularity of Fe(III)-Al(III) in the Extraction of Indium from Waste TFT-LCD. Positive and Negative Impacts of Carbon Taxes in China: A Cost-Benefit PerspectiveChemical and Mineralogical Characterizations of Cobalt Precursor Recovered from Spent Lithium-Ion Batteries with Incineration Process; A Life-Cycle Based Approach to the Remanufacturing Printing Supplies in Shanghai; Literature Review and Prospect on the End-of-Life Vehicles Reverse Logistics; The Decision on Reserve Logistics Network Structure of End-of-Life Vehicles Recycling; Composition Determination of Vehicle Dismantling Waste; Comparison Study of Scrap Tires Management between China and the USA. Possibility of BFRs Extraction from E-WasteWood-Plastic Composites Prepared by Waste Polypropylene and Toughening; Metals Contamination and Leaching Potential in Plastic Toys Bought on the Beijing Market; Current Status of Fiber Waste Recycling and its Future; Study on Special Recycling of PVC Plastics Promoted by School Students in Tianjin; Biomethane by Psychrophilic Methanogenic Community Isolated from Sediment of Crane Lake in Zhalong Wetland, Northeast China; Chapter 2: Industrial Waste; Efficient Extraction of SiO2 and Al2O3 from Coal Gangue by Means of Acidic Leaching Development of Tailings Based Polymer-Modified Waterproof MortarThe Process and Mechanism of Electrolytic Manganese Anode Slime Lead Removal; Mechanical Properties and Microstructure Analysis of Copper Tailings Solidifying with Different Cementitious Materials; Co-Pyrolysis Characteristics and Product Distributions of Coal Tailings and Biomass Blends; Enhanced Chromium Recovery from Tannery Waste by Acid-Alkali Reaction in China; Autoclaved Brick from Steel Slag and Silicon Tailings; Characterization of a Sorbent Derived from Construction and Demolition Waste Comparing Analysis on the Way of Tailings Disposal in China and AustraliaDischarge and Disposal of Coal Gasification Methanol Production Residue and Distribution Characteristics of PAHs in it; Assessing the Life Cycle Environmental and Economic Performance of Copper Slag Recycling; Removal of Phenol from Aqueous Solutions by Adsorption onto Amine-Modified Fly Ash Cenospheres (FACs); Experimental Study on Comprehensive Recovery of Valuable Minerals from Flotation Tailings in Copper-Molybdenum Mine; Enhanced Steelmaking Slag Mineral Carbonation in Dilute Alkali Solution With the development of industry and the improvement of living standards, the amount of solid waste is increasing rapidly. New research and industries solutions in the field of waste management and recycling become increasingly important. The volume highlights the academic and policy trends on waste management and collects the latest research trends and innovative ideas in the solid waste field. The peer reviewed papers are grouped as follows: Chapter 1. Circular Economy and Urban Mining; Chapter 2. Industrial Waste; Chapter 3. Electrical and Electronic Waste; Chapter 4. Biomass Energy; Chapte |
ctrlnum | (ZDB-4-EBA)ocn878138233 (OCoLC)878138233 (DE-599)BVBBV043780900 |
dewey-full | 628.445 |
dewey-hundreds | 600 - Technology (Applied sciences) |
dewey-ones | 628 - Sanitary engineering |
dewey-raw | 628.445 |
dewey-search | 628.445 |
dewey-sort | 3628.445 |
dewey-tens | 620 - Engineering and allied operations |
discipline | Bauingenieurwesen |
format | Electronic eBook |
fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>06238nam a2200577zcb4500</leader><controlfield tag="001">BV043780900</controlfield><controlfield tag="003">DE-604</controlfield><controlfield tag="005">00000000000000.0</controlfield><controlfield tag="007">cr|uuu---uuuuu</controlfield><controlfield tag="008">160920s2014 xx ao|| o|||| 00||| eng d</controlfield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9783038263630</subfield><subfield code="9">978-3-03826-363-0</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">303826363X</subfield><subfield code="9">3-03826-363-X</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9783037859827</subfield><subfield code="9">978-3-03785-982-7</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(ZDB-4-EBA)ocn878138233</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)878138233</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-599)BVBBV043780900</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-604</subfield><subfield code="b">ger</subfield><subfield code="e">rda</subfield></datafield><datafield tag="041" ind1="0" ind2=" "><subfield code="a">eng</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-1046</subfield><subfield code="a">DE-1047</subfield></datafield><datafield tag="082" ind1="0" ind2=" "><subfield code="a">628.445</subfield><subfield code="2">23</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Selected proceedings of the eighth International Conference on Waste Management and Technology</subfield><subfield code="b">selected, peer reviewed papers from the eighth International Conference on Waste Management and Technology (ICWMT 8), October 23-25, 2013, Shanghai, China</subfield><subfield code="c">edited by Jinhui Li and Hualong Hu</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">Zurich, Switzerland</subfield><subfield code="b">Trans Tech Publications</subfield><subfield code="c">[2014]</subfield></datafield><datafield tag="264" ind1=" " ind2="4"><subfield code="c">© 2014</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">1 online resource (926 pages)</subfield><subfield code="b">illustrations (some color), graphs, photographs</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="b">c</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="b">cr</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="490" ind1="0" ind2=" "><subfield code="a">Advanced materials research</subfield><subfield code="v">v. 878</subfield></datafield><datafield tag="500" ind1=" " ind2=" "><subfield code="a">"Towards ecological civilization"--Cover</subfield></datafield><datafield tag="500" ind1=" " ind2=" "><subfield code="a">Online resource; title from PDF title page (ebrary, viewed March 20, 2014)</subfield></datafield><datafield tag="505" ind1="8" ind2=" "><subfield code="a">Selected Proceedings of the Eighth International Conference on Waste Management and Technology; Preface and Editorial Board; Table of Contents; Chapter 1: Circular Economy and Urban Mining; Towards Integrated Municipal Solid Waste Management: A Case of Urumqi, China; Import & Export Management for Waste Raw Materials between China and Japan; Municipal Solid Waste Management Practice in China -- A Case Study in Hangzhou; Substance Flow Analysis of Lead for Sustainable Resource Management and Pollution Control; Transfer Regularity of Fe(III)-Al(III) in the Extraction of Indium from Waste TFT-LCD.</subfield></datafield><datafield tag="505" ind1="8" ind2=" "><subfield code="a">Positive and Negative Impacts of Carbon Taxes in China: A Cost-Benefit PerspectiveChemical and Mineralogical Characterizations of Cobalt Precursor Recovered from Spent Lithium-Ion Batteries with Incineration Process; A Life-Cycle Based Approach to the Remanufacturing Printing Supplies in Shanghai; Literature Review and Prospect on the End-of-Life Vehicles Reverse Logistics; The Decision on Reserve Logistics Network Structure of End-of-Life Vehicles Recycling; Composition Determination of Vehicle Dismantling Waste; Comparison Study of Scrap Tires Management between China and the USA.</subfield></datafield><datafield tag="505" ind1="8" ind2=" "><subfield code="a">Possibility of BFRs Extraction from E-WasteWood-Plastic Composites Prepared by Waste Polypropylene and Toughening; Metals Contamination and Leaching Potential in Plastic Toys Bought on the Beijing Market; Current Status of Fiber Waste Recycling and its Future; Study on Special Recycling of PVC Plastics Promoted by School Students in Tianjin; Biomethane by Psychrophilic Methanogenic Community Isolated from Sediment of Crane Lake in Zhalong Wetland, Northeast China; Chapter 2: Industrial Waste; Efficient Extraction of SiO2 and Al2O3 from Coal Gangue by Means of Acidic Leaching</subfield></datafield><datafield tag="505" ind1="8" ind2=" "><subfield code="a">Development of Tailings Based Polymer-Modified Waterproof MortarThe Process and Mechanism of Electrolytic Manganese Anode Slime Lead Removal; Mechanical Properties and Microstructure Analysis of Copper Tailings Solidifying with Different Cementitious Materials; Co-Pyrolysis Characteristics and Product Distributions of Coal Tailings and Biomass Blends; Enhanced Chromium Recovery from Tannery Waste by Acid-Alkali Reaction in China; Autoclaved Brick from Steel Slag and Silicon Tailings; Characterization of a Sorbent Derived from Construction and Demolition Waste</subfield></datafield><datafield tag="505" ind1="8" ind2=" "><subfield code="a">Comparing Analysis on the Way of Tailings Disposal in China and AustraliaDischarge and Disposal of Coal Gasification Methanol Production Residue and Distribution Characteristics of PAHs in it; Assessing the Life Cycle Environmental and Economic Performance of Copper Slag Recycling; Removal of Phenol from Aqueous Solutions by Adsorption onto Amine-Modified Fly Ash Cenospheres (FACs); Experimental Study on Comprehensive Recovery of Valuable Minerals from Flotation Tailings in Copper-Molybdenum Mine; Enhanced Steelmaking Slag Mineral Carbonation in Dilute Alkali Solution</subfield></datafield><datafield tag="505" ind1="8" ind2=" "><subfield code="a">With the development of industry and the improvement of living standards, the amount of solid waste is increasing rapidly. New research and industries solutions in the field of waste management and recycling become increasingly important. The volume highlights the academic and policy trends on waste management and collects the latest research trends and innovative ideas in the solid waste field. The peer reviewed papers are grouped as follows: Chapter 1. Circular Economy and Urban Mining; Chapter 2. Industrial Waste; Chapter 3. Electrical and Electronic Waste; Chapter 4. Biomass Energy; Chapte</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">TECHNOLOGY & ENGINEERING / Environmental / General</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Recycling (Waste, etc.)</subfield><subfield code="2">fast</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Refuse and refuse disposal</subfield><subfield code="2">fast</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Waste disposal sites / Environmental aspects</subfield><subfield code="2">fast</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Waste minimization</subfield><subfield code="2">fast</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Umwelt</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Refuse and refuse disposal</subfield><subfield code="v">Congresses</subfield><subfield code="a">Recycling (Waste, etc.)</subfield><subfield code="v">Congresses</subfield><subfield code="a">Waste minimization</subfield><subfield code="v">Congresses</subfield><subfield code="a">Waste disposal sites</subfield><subfield code="x">Environmental aspects</subfield><subfield code="v">Congresses</subfield></datafield><datafield tag="655" ind1=" " ind2="7"><subfield code="0">(DE-588)1071861417</subfield><subfield code="a">Konferenzschrift</subfield><subfield code="2">gnd-content</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Li, Jinhui</subfield><subfield code="4">edt</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Hu, Hualong</subfield><subfield code="4">edt</subfield></datafield><datafield tag="776" ind1="0" ind2="8"><subfield code="i">Erscheint auch als</subfield><subfield code="n">Druck-Ausgabe</subfield><subfield code="a">Selected proceedings of the eighth International Conference on Waste Management and Technology : selected, peer reviewed papers from the eighth International Conference on Waste Management and Technology (ICWMT 8), October 23-25, 2013, Shanghai, China</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">ZDB-4-EBA</subfield></datafield><datafield tag="943" ind1="1" ind2=" "><subfield code="a">oai:aleph.bib-bvb.de:BVB01-029191960</subfield></datafield><datafield tag="966" ind1="e" ind2=" "><subfield code="u">http://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=696651</subfield><subfield code="l">DE-1046</subfield><subfield code="p">ZDB-4-EBA</subfield><subfield code="q">FAW_PDA_EBA</subfield><subfield code="x">Aggregator</subfield><subfield code="3">Volltext</subfield></datafield><datafield tag="966" ind1="e" ind2=" "><subfield code="u">http://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=696651</subfield><subfield code="l">DE-1047</subfield><subfield code="p">ZDB-4-EBA</subfield><subfield code="q">FAW_PDA_EBA</subfield><subfield code="x">Aggregator</subfield><subfield code="3">Volltext</subfield></datafield></record></collection> |
genre | (DE-588)1071861417 Konferenzschrift gnd-content |
genre_facet | Konferenzschrift |
id | DE-604.BV043780900 |
illustrated | Illustrated |
indexdate | 2024-12-20T17:45:02Z |
institution | BVB |
isbn | 9783038263630 303826363X 9783037859827 |
language | English |
oai_aleph_id | oai:aleph.bib-bvb.de:BVB01-029191960 |
oclc_num | 878138233 |
open_access_boolean | |
owner | DE-1046 DE-1047 |
owner_facet | DE-1046 DE-1047 |
physical | 1 online resource (926 pages) illustrations (some color), graphs, photographs |
psigel | ZDB-4-EBA ZDB-4-EBA FAW_PDA_EBA |
publishDate | 2014 |
publishDateSearch | 2014 |
publishDateSort | 2014 |
publisher | Trans Tech Publications |
record_format | marc |
series2 | Advanced materials research |
spelling | Selected proceedings of the eighth International Conference on Waste Management and Technology selected, peer reviewed papers from the eighth International Conference on Waste Management and Technology (ICWMT 8), October 23-25, 2013, Shanghai, China edited by Jinhui Li and Hualong Hu Zurich, Switzerland Trans Tech Publications [2014] © 2014 1 online resource (926 pages) illustrations (some color), graphs, photographs txt rdacontent c rdamedia cr rdacarrier Advanced materials research v. 878 "Towards ecological civilization"--Cover Online resource; title from PDF title page (ebrary, viewed March 20, 2014) Selected Proceedings of the Eighth International Conference on Waste Management and Technology; Preface and Editorial Board; Table of Contents; Chapter 1: Circular Economy and Urban Mining; Towards Integrated Municipal Solid Waste Management: A Case of Urumqi, China; Import & Export Management for Waste Raw Materials between China and Japan; Municipal Solid Waste Management Practice in China -- A Case Study in Hangzhou; Substance Flow Analysis of Lead for Sustainable Resource Management and Pollution Control; Transfer Regularity of Fe(III)-Al(III) in the Extraction of Indium from Waste TFT-LCD. Positive and Negative Impacts of Carbon Taxes in China: A Cost-Benefit PerspectiveChemical and Mineralogical Characterizations of Cobalt Precursor Recovered from Spent Lithium-Ion Batteries with Incineration Process; A Life-Cycle Based Approach to the Remanufacturing Printing Supplies in Shanghai; Literature Review and Prospect on the End-of-Life Vehicles Reverse Logistics; The Decision on Reserve Logistics Network Structure of End-of-Life Vehicles Recycling; Composition Determination of Vehicle Dismantling Waste; Comparison Study of Scrap Tires Management between China and the USA. Possibility of BFRs Extraction from E-WasteWood-Plastic Composites Prepared by Waste Polypropylene and Toughening; Metals Contamination and Leaching Potential in Plastic Toys Bought on the Beijing Market; Current Status of Fiber Waste Recycling and its Future; Study on Special Recycling of PVC Plastics Promoted by School Students in Tianjin; Biomethane by Psychrophilic Methanogenic Community Isolated from Sediment of Crane Lake in Zhalong Wetland, Northeast China; Chapter 2: Industrial Waste; Efficient Extraction of SiO2 and Al2O3 from Coal Gangue by Means of Acidic Leaching Development of Tailings Based Polymer-Modified Waterproof MortarThe Process and Mechanism of Electrolytic Manganese Anode Slime Lead Removal; Mechanical Properties and Microstructure Analysis of Copper Tailings Solidifying with Different Cementitious Materials; Co-Pyrolysis Characteristics and Product Distributions of Coal Tailings and Biomass Blends; Enhanced Chromium Recovery from Tannery Waste by Acid-Alkali Reaction in China; Autoclaved Brick from Steel Slag and Silicon Tailings; Characterization of a Sorbent Derived from Construction and Demolition Waste Comparing Analysis on the Way of Tailings Disposal in China and AustraliaDischarge and Disposal of Coal Gasification Methanol Production Residue and Distribution Characteristics of PAHs in it; Assessing the Life Cycle Environmental and Economic Performance of Copper Slag Recycling; Removal of Phenol from Aqueous Solutions by Adsorption onto Amine-Modified Fly Ash Cenospheres (FACs); Experimental Study on Comprehensive Recovery of Valuable Minerals from Flotation Tailings in Copper-Molybdenum Mine; Enhanced Steelmaking Slag Mineral Carbonation in Dilute Alkali Solution With the development of industry and the improvement of living standards, the amount of solid waste is increasing rapidly. New research and industries solutions in the field of waste management and recycling become increasingly important. The volume highlights the academic and policy trends on waste management and collects the latest research trends and innovative ideas in the solid waste field. The peer reviewed papers are grouped as follows: Chapter 1. Circular Economy and Urban Mining; Chapter 2. Industrial Waste; Chapter 3. Electrical and Electronic Waste; Chapter 4. Biomass Energy; Chapte TECHNOLOGY & ENGINEERING / Environmental / General bisacsh Recycling (Waste, etc.) fast Refuse and refuse disposal fast Waste disposal sites / Environmental aspects fast Waste minimization fast Umwelt Refuse and refuse disposal Congresses Recycling (Waste, etc.) Congresses Waste minimization Congresses Waste disposal sites Environmental aspects Congresses (DE-588)1071861417 Konferenzschrift gnd-content Li, Jinhui edt Hu, Hualong edt Erscheint auch als Druck-Ausgabe Selected proceedings of the eighth International Conference on Waste Management and Technology : selected, peer reviewed papers from the eighth International Conference on Waste Management and Technology (ICWMT 8), October 23-25, 2013, Shanghai, China |
spellingShingle | Selected proceedings of the eighth International Conference on Waste Management and Technology selected, peer reviewed papers from the eighth International Conference on Waste Management and Technology (ICWMT 8), October 23-25, 2013, Shanghai, China Selected Proceedings of the Eighth International Conference on Waste Management and Technology; Preface and Editorial Board; Table of Contents; Chapter 1: Circular Economy and Urban Mining; Towards Integrated Municipal Solid Waste Management: A Case of Urumqi, China; Import & Export Management for Waste Raw Materials between China and Japan; Municipal Solid Waste Management Practice in China -- A Case Study in Hangzhou; Substance Flow Analysis of Lead for Sustainable Resource Management and Pollution Control; Transfer Regularity of Fe(III)-Al(III) in the Extraction of Indium from Waste TFT-LCD. Positive and Negative Impacts of Carbon Taxes in China: A Cost-Benefit PerspectiveChemical and Mineralogical Characterizations of Cobalt Precursor Recovered from Spent Lithium-Ion Batteries with Incineration Process; A Life-Cycle Based Approach to the Remanufacturing Printing Supplies in Shanghai; Literature Review and Prospect on the End-of-Life Vehicles Reverse Logistics; The Decision on Reserve Logistics Network Structure of End-of-Life Vehicles Recycling; Composition Determination of Vehicle Dismantling Waste; Comparison Study of Scrap Tires Management between China and the USA. Possibility of BFRs Extraction from E-WasteWood-Plastic Composites Prepared by Waste Polypropylene and Toughening; Metals Contamination and Leaching Potential in Plastic Toys Bought on the Beijing Market; Current Status of Fiber Waste Recycling and its Future; Study on Special Recycling of PVC Plastics Promoted by School Students in Tianjin; Biomethane by Psychrophilic Methanogenic Community Isolated from Sediment of Crane Lake in Zhalong Wetland, Northeast China; Chapter 2: Industrial Waste; Efficient Extraction of SiO2 and Al2O3 from Coal Gangue by Means of Acidic Leaching Development of Tailings Based Polymer-Modified Waterproof MortarThe Process and Mechanism of Electrolytic Manganese Anode Slime Lead Removal; Mechanical Properties and Microstructure Analysis of Copper Tailings Solidifying with Different Cementitious Materials; Co-Pyrolysis Characteristics and Product Distributions of Coal Tailings and Biomass Blends; Enhanced Chromium Recovery from Tannery Waste by Acid-Alkali Reaction in China; Autoclaved Brick from Steel Slag and Silicon Tailings; Characterization of a Sorbent Derived from Construction and Demolition Waste Comparing Analysis on the Way of Tailings Disposal in China and AustraliaDischarge and Disposal of Coal Gasification Methanol Production Residue and Distribution Characteristics of PAHs in it; Assessing the Life Cycle Environmental and Economic Performance of Copper Slag Recycling; Removal of Phenol from Aqueous Solutions by Adsorption onto Amine-Modified Fly Ash Cenospheres (FACs); Experimental Study on Comprehensive Recovery of Valuable Minerals from Flotation Tailings in Copper-Molybdenum Mine; Enhanced Steelmaking Slag Mineral Carbonation in Dilute Alkali Solution With the development of industry and the improvement of living standards, the amount of solid waste is increasing rapidly. New research and industries solutions in the field of waste management and recycling become increasingly important. The volume highlights the academic and policy trends on waste management and collects the latest research trends and innovative ideas in the solid waste field. The peer reviewed papers are grouped as follows: Chapter 1. Circular Economy and Urban Mining; Chapter 2. Industrial Waste; Chapter 3. Electrical and Electronic Waste; Chapter 4. Biomass Energy; Chapte TECHNOLOGY & ENGINEERING / Environmental / General bisacsh Recycling (Waste, etc.) fast Refuse and refuse disposal fast Waste disposal sites / Environmental aspects fast Waste minimization fast Umwelt Refuse and refuse disposal Congresses Recycling (Waste, etc.) Congresses Waste minimization Congresses Waste disposal sites Environmental aspects Congresses |
subject_GND | (DE-588)1071861417 |
title | Selected proceedings of the eighth International Conference on Waste Management and Technology selected, peer reviewed papers from the eighth International Conference on Waste Management and Technology (ICWMT 8), October 23-25, 2013, Shanghai, China |
title_auth | Selected proceedings of the eighth International Conference on Waste Management and Technology selected, peer reviewed papers from the eighth International Conference on Waste Management and Technology (ICWMT 8), October 23-25, 2013, Shanghai, China |
title_exact_search | Selected proceedings of the eighth International Conference on Waste Management and Technology selected, peer reviewed papers from the eighth International Conference on Waste Management and Technology (ICWMT 8), October 23-25, 2013, Shanghai, China |
title_full | Selected proceedings of the eighth International Conference on Waste Management and Technology selected, peer reviewed papers from the eighth International Conference on Waste Management and Technology (ICWMT 8), October 23-25, 2013, Shanghai, China edited by Jinhui Li and Hualong Hu |
title_fullStr | Selected proceedings of the eighth International Conference on Waste Management and Technology selected, peer reviewed papers from the eighth International Conference on Waste Management and Technology (ICWMT 8), October 23-25, 2013, Shanghai, China edited by Jinhui Li and Hualong Hu |
title_full_unstemmed | Selected proceedings of the eighth International Conference on Waste Management and Technology selected, peer reviewed papers from the eighth International Conference on Waste Management and Technology (ICWMT 8), October 23-25, 2013, Shanghai, China edited by Jinhui Li and Hualong Hu |
title_short | Selected proceedings of the eighth International Conference on Waste Management and Technology |
title_sort | selected proceedings of the eighth international conference on waste management and technology selected peer reviewed papers from the eighth international conference on waste management and technology icwmt 8 october 23 25 2013 shanghai china |
title_sub | selected, peer reviewed papers from the eighth International Conference on Waste Management and Technology (ICWMT 8), October 23-25, 2013, Shanghai, China |
topic | TECHNOLOGY & ENGINEERING / Environmental / General bisacsh Recycling (Waste, etc.) fast Refuse and refuse disposal fast Waste disposal sites / Environmental aspects fast Waste minimization fast Umwelt Refuse and refuse disposal Congresses Recycling (Waste, etc.) Congresses Waste minimization Congresses Waste disposal sites Environmental aspects Congresses |
topic_facet | TECHNOLOGY & ENGINEERING / Environmental / General Recycling (Waste, etc.) Refuse and refuse disposal Waste disposal sites / Environmental aspects Waste minimization Umwelt Refuse and refuse disposal Congresses Recycling (Waste, etc.) Congresses Waste minimization Congresses Waste disposal sites Environmental aspects Congresses Konferenzschrift |
work_keys_str_mv | AT lijinhui selectedproceedingsoftheeighthinternationalconferenceonwastemanagementandtechnologyselectedpeerreviewedpapersfromtheeighthinternationalconferenceonwastemanagementandtechnologyicwmt8october23252013shanghaichina AT huhualong selectedproceedingsoftheeighthinternationalconferenceonwastemanagementandtechnologyselectedpeerreviewedpapersfromtheeighthinternationalconferenceonwastemanagementandtechnologyicwmt8october23252013shanghaichina |