Konstrukce etnické identity a kolektivní paměti v biografických vyprávěních českých Němců: na příkladu vzpomínek Němců na Chomutovsku
Gespeichert in:
Beteilige Person: | |
---|---|
Format: | Buch |
Sprache: | Tschechisch |
Veröffentlicht: |
Praha
Univ. Karlova, Filozofická Fak.
2013
|
Ausgabe: | Vyd. 1. |
Schriftenreihe: | Humanitas
6 |
Schlagwörter: | |
Links: | https://www.recensio.net/r/e71362ebc9e34b08a05e2b70184dc020 http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=027077875&sequence=000003&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=027077875&sequence=000004&line_number=0002&func_code=DB_RECORDS&service_type=MEDIA |
Beschreibung: | Zsfassung in dt. und engl. Sprache |
Umfang: | 194 S. Ill. |
ISBN: | 9788073084844 |
Internformat
MARC
LEADER | 00000nam a2200000 cb4500 | ||
---|---|---|---|
001 | BV041637004 | ||
003 | DE-604 | ||
005 | 20141106 | ||
007 | t| | ||
008 | 140207s2013 xx a||| |||| 00||| cze d | ||
020 | |a 9788073084844 |9 978-80-7308-484-4 | ||
035 | |a (OCoLC)879549858 | ||
035 | |a (DE-599)BVBBV041637004 | ||
040 | |a DE-604 |b ger |e rakwb | ||
041 | 0 | |a cze | |
049 | |a DE-12 |a DE-M457 | ||
084 | |a KS 1215 |0 (DE-625)83776: |2 rvk | ||
084 | |a 7,41 |2 ssgn | ||
100 | 1 | |a Kreisslová, Sandra |d 1981- |e Verfasser |0 (DE-588)1050382153 |4 aut | |
245 | 1 | 0 | |a Konstrukce etnické identity a kolektivní paměti v biografických vyprávěních českých Němců |b na příkladu vzpomínek Němců na Chomutovsku |c Sandra Kreisslová |
250 | |a Vyd. 1. | ||
264 | 1 | |a Praha |b Univ. Karlova, Filozofická Fak. |c 2013 | |
300 | |a 194 S. |b Ill. | ||
336 | |b txt |2 rdacontent | ||
337 | |b n |2 rdamedia | ||
338 | |b nc |2 rdacarrier | ||
490 | 1 | |a Humanitas |v 6 | |
500 | |a Zsfassung in dt. und engl. Sprache | ||
648 | 7 | |a Geschichte 1900-2000 |2 gnd |9 rswk-swf | |
650 | 0 | 7 | |a Kollektives Gedächtnis |0 (DE-588)4200793-8 |2 gnd |9 rswk-swf |
650 | 0 | 7 | |a Ethnische Identität |0 (DE-588)4153096-2 |2 gnd |9 rswk-swf |
650 | 0 | 7 | |a Sudetendeutsche |0 (DE-588)4058386-7 |2 gnd |9 rswk-swf |
651 | 7 | |a Chomutov |z Region |0 (DE-588)4403374-6 |2 gnd |9 rswk-swf | |
689 | 0 | 0 | |a Chomutov |z Region |0 (DE-588)4403374-6 |D g |
689 | 0 | 1 | |a Sudetendeutsche |0 (DE-588)4058386-7 |D s |
689 | 0 | 2 | |a Ethnische Identität |0 (DE-588)4153096-2 |D s |
689 | 0 | 3 | |a Kollektives Gedächtnis |0 (DE-588)4200793-8 |D s |
689 | 0 | 4 | |a Geschichte 1900-2000 |A z |
689 | 0 | |5 DE-604 | |
830 | 0 | |a Humanitas |v 6 |w (DE-604)BV036081649 |9 6 | |
856 | 4 | 2 | |u https://www.recensio.net/r/e71362ebc9e34b08a05e2b70184dc020 |y rezensiert in: Bohemia, 56 (2016), 2, S. 518-520 |3 Rezension |
856 | 4 | 2 | |m Digitalisierung BSB Muenchen 19 - ADAM Catalogue Enrichment |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=027077875&sequence=000003&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |3 Inhaltsverzeichnis |
856 | 4 | 2 | |m Digitalisierung BSB Muenchen 19 - ADAM Catalogue Enrichment |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=027077875&sequence=000004&line_number=0002&func_code=DB_RECORDS&service_type=MEDIA |3 Abstract |
940 | 1 | |n DHB | |
940 | 1 | |n oe | |
940 | 1 | |q DHB_BSB_DDC1 | |
940 | 1 | |q DHB_JDG_ISBN_1 | |
942 | 1 | 1 | |c 900 |e 22/bsb |f 0904 |g 4371 |
942 | 1 | 1 | |c 900 |e 22/bsb |f 0904 |g 43 |
943 | 1 | |a oai:aleph.bib-bvb.de:BVB01-027077875 |
Datensatz im Suchindex
_version_ | 1822694036836712448 |
---|---|
adam_text |
Obsah
Úvodem
7
1. Teoreticko-metodologická východiska
14
Dosavadní stav studia zkoumané problematiky
14
Kolektivní identita
21
Pojem identity ve společenskovědním diskurzu
21
Konstruktivistické pojetí kolektivní identity
27
Etnicita jako specifická forma kolektivní identity
30
Etnická stereotypizace
-
obrazy o „nás" a „těch druhých"
36
Kolektivní paměť
43
Kolektivní paměť jako sociální konstrukt
43
Kulturní a komunikativní rámce paměti
50
Kolektivní paměť a kolektivní trauma
53
Problematika identity a paměti ve světle biografického bádání
56
2.
Interpretace životopisných vyprávění českých Němců
66
Několik poznámek
к
vlastnímu biografickému výzkumu
66
Seznam narátorů
s
biografickými údaji
70
Etnická identifikace a vzpomínání mezi/válečné
generace českých Němců
75
Etnicita jako otevřená kategorie
77
Etnicita jako nepropustná kategorie
87
Etnicita jako
stigmatizovaná
kategorie
106
Etnicita jako zamlčovaná a asimilovaná kategorie
128
Etnicita jako znovu oživená kategorie?
141
К
etnickému a jazykovému vědomí českých Němců
ve světle mezigeneračního srovnání
149
Na pomezí dvou životních světů
-
příklady etnické
a jazykové identity generace „vnoučat"
161
Závěrem
169
Literatura
173
Jmenný rejstřík
188
Resumé
/ Zusammenfassung /
Summary
191
/ Zusammenfassung
Die vorliegende Studie untersucht das Phänomen der intersubjek¬
tiven Identitätskonstruktion, konkret die Konstruktion von ethni¬
scher Identität und die damit verbundenen Identifikationsmerkmale.
Diese diskursive Bildung ethnischer Identität als eine bestimmte Art
kollektiver Identität wurde anhand lebensgeschichtlich-narrativer
Interviews nachgezeichnet, welche beginnend mit der Zwischen¬
kriegszeit- und Kriegsgeneration der böhmischen Deutschen und
ihrer Nachkommen, die nach der Zwangsaussiedlung der deutsch¬
sprachigen Bevölkerung aus der Tschechoslowakei in ihrer Heimat
verblieben, durchgeführt wurden.
Der erste Teil der Arbeit kann als theoretische Einführung be¬
trachtet werden. Dabei werden grundlegende Werke, Konzepte und
theoretische Ansätze zur Untersuchung von kollektiver Identität
und kollektiver Erinnerung vorgestellt. Diese durch das Paradigma
des Sozialkonstruktivismus inspirierten Überlegungen enden mit
theoretisch-methodologischen Fragen der Beziehung zwischen kol¬
lektiver Identität, Gedächtnis und biographischer Erzählung. Die
eingewobenen biographischen Texte führten zu den individuellen
und kollektiven Erinnerungen der Befragten, das Konzept des Ge¬
dächtnisses wurde also für die Erfassung der ethnischen Identität als
grundlegend angenommen. Die Teilnahme von Personen am kollek¬
tiv geteilten Wissen über die Vergangenheit führt zur Bildung von
Gruppenzusammengehörigkeit und ist so ein wichtiger Bestand¬
teil der kollektiven Identität. Zudem manifestierten sich in den Le¬
bensgeschichten auch weitere Merkmale der Ethnizität wie z. B. die
Sprache und kulturelle Besonderheiten.
Der darauf folgende Abschnitt des Buches widmet sich der Ana¬
lyse und Interpretation der gewonnen Daten. Insgesamt wurden in
der Region Chomutov/Komotau 50 biographische Erzählungen der
Vertreter dreier aufeinander folgender Generationen von böhmi¬
schen Deutschen aufgezeichnet. An erster Stelle wurden kollektiv
geteilte Bilder der Vergangenheit und die wichtigsten Merkmale,
durch die die Akteure der ältesten Generation der Zwischenkriegs-
und Kriegszeit ihre ethnische Identität konstruieren, verfolgt. Es
191
wurde erläutert, wie die Erzähler gleichzeitig ihr subjektiv erlebtes
„Wir-Gefühl" konstruieren und interpretieren und sich gegenüber
den Nicht-Mitgliedern der eigenen Gruppe abgrenzen. Wohl auf¬
grund der traumatischen Erinnerungen aus der Kriegs- und Nach¬
kriegszeit war gerade diese am intensivsten in den Lebensgeschich¬
ten der Zeitzeugen präsent. Die intersubjektiven Erfahrungen aus
dieser Zeit und ihre stigmatisierende Aspekte können als wichtige
Bestandteile des kollektiven Gedächtnisses und der Identität dieser
Generation, die sich bis heute mit dem Opfer- und Tatertraumata
auseinandersetzen, festgestellt werden. Trotz dieser Stigmatisierung
wurde die deutsche Identität von den Erzählern als eine unverän¬
derliche und
primordiale
Kategorie wahrgenommen. Ihr „Deutsch-
bewusstsein" macht sich vor allem an der deutschen Sprache und
deutschen Herkunft fest.
Ebenfalls thematisiert wird die Frage der Weitergabe der eth¬
nischen und sprachlichen Identität der ältesten Generation der
böhmischen Deutschen an ihre Nachkommen. Zu diesem Zweck
wurden die Biographien von weiteren zwei Generationsgruppen
analysiert. Diese Untersuchung zeigte, wie und wodurch die Erzäh¬
ler diskursiv ihre eigene ethnische Identität konstruieren und wel¬
che Rolle während dieses Prozesses das ethnische und sprachliche
Bewusstsein ihrer Vorfahren spielte. Während bei der Zwischen¬
kriegs- und Kriegsgeneration die deutsche ethno-kulturelle Identität
stabil internalisiert war, konnte man bei den jüngeren Generationen
schon eine ethnische und sprachliche Verschiebung in tschechi¬
scher Richtung feststellen. Den Übergang von der deutschen zur
tschechischen Identität bildete bereits die mittlere „sozialistische"
Generation. Als grundlegende Faktoren dabei erwiesen sich etwa
interethnische Ehen, das überwiegende tschechische Umfeld und
das niedrige Prestige der deutschen Identität und Sprache während
der sozialistischen Zeit. Die Assimilationsresistenz gegenüber dem
tschechischen Umfeld war so eher die Ausnahme. Zwar lassen sich
Fälle von doppelten Identitätskonstruktionen ausmachen, in der Re¬
gel wurde aber die deutsche Identität nun mehr mit der Lebenswelt
der Großeltern bzw. der Eltern in Verbindung gebracht.
RESUMÉ
/ ZUSAMMENFASSUNG
Resumé
/
Summary
The present study examined the phenomenon of inter-subjective
identity constructions, specifically ethnic identity constructions and
their associated identifiers. This discursive creation of ethnic identity,
as a specific type of collective identity, was monitored on the basis of
biographic narrative interviews with the representatives of the oldest
interwar and war generation of Germans and their descendants (their
children and grandchildren's generation) who, after the expulsion of
most of the German-speaking population in Czechoslovakia, stayed
in their country of origin for various reasons.
The first part of the study can be considered a theoretical
excursion introducing the essential works, concepts and theoretical
approaches to the study of collective identity and collective memory.
These reflections, inspired by the paradigm of social constructivism,
concluded the theoretical and methodological issues showing the
relationship between collective identity, memory and biographical
narration. The acquired biographical perforce lead us to memory
(individual and collective), which was viewed as essential to
understanding ethnic identities. The participation of individuals on
collectively shared knowledge about the past actually creates and
maintains group solidarity, thus making up one of the important
components of collective identity. Through life stories there were
also manifested additional attributes used for the construction of
ethnicity such as the distinct language and culture.
The following section of the book is devoted to the analysis and
interpretation of acquired data. Using the biographical method
during the personally performed field research in the
Chomutov
region brought about a total of
50
recorded stories from the
biographical narratives of representatives of three successive
generations of Czech Germans. The study primarily captures the
collectively shared images of the past and important identifying
attributes which formed the ethnic identity of the protagonists of
the oldest interwar generation of this community. The study has
clarified, as narrators themselves re-constructed and re-interpreted,
their subjectively experienced "us" and at the same time how they
193
defined themselves against the non-members of the "others" group.
Apparently, because of its traumatic potential, the group most
intensely preserved the memories from the period before and after
wartime. The inter-subjective experience of this historical period
and its stigmatizing aspect could thus be understood as one of the
main attributes of collective memory and identity of this generational
group, which is still coping with the collective trauma of perpetrators
and victims. Despite this potential stigma, the German identity
is seen by the narrators as an immutable and primordially given
entity and their identification is derived from German language and
ethnicity.
Furthermore, the study discusses the intergenerational trans¬
mission of ethnic and linguistic identity from the oldest generation
of Czech Germans on their offspring. To this end, the biographies
of protagonists of the following two generational groups became
the subject of analysis and interpretation. This examination of
intergenerational relationships revealed how and through what the
narrators discursively created their own ethnic identity and what
level of importance their ancestors' ethnic and linguistic knowledge
has reached during this process. While the German ethno-cul
turai
identity was fixed and internalized in case of the interwar generation,
we identified both ethnic and language shifts in the Czech
direction in case of the younger generations, where the transition
from German to Czech identity consisted of a central "socialist"
generation. The fundamental factors for the diversion from German
Identity proved to be the mixed marriages, dominating the Czech
environment and, in terms of the communist regime, the low prestige
of German identity and language. Assimilation resistance against
foreign-ethnical environment was an exception and there appeared
a discourse of dual identity, however as a rule, German identity has
been associated only with the lifeworld of grandparents/parents.
194
RESUMÉ
/
SUMMARY |
any_adam_object | 1 |
author | Kreisslová, Sandra 1981- |
author_GND | (DE-588)1050382153 |
author_facet | Kreisslová, Sandra 1981- |
author_role | aut |
author_sort | Kreisslová, Sandra 1981- |
author_variant | s k sk |
building | Verbundindex |
bvnumber | BV041637004 |
classification_rvk | KS 1215 |
ctrlnum | (OCoLC)879549858 (DE-599)BVBBV041637004 |
discipline | Slavistik |
edition | Vyd. 1. |
era | Geschichte 1900-2000 gnd |
era_facet | Geschichte 1900-2000 |
format | Book |
fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>00000nam a2200000 cb4500</leader><controlfield tag="001">BV041637004</controlfield><controlfield tag="003">DE-604</controlfield><controlfield tag="005">20141106</controlfield><controlfield tag="007">t|</controlfield><controlfield tag="008">140207s2013 xx a||| |||| 00||| cze d</controlfield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9788073084844</subfield><subfield code="9">978-80-7308-484-4</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)879549858</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-599)BVBBV041637004</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-604</subfield><subfield code="b">ger</subfield><subfield code="e">rakwb</subfield></datafield><datafield tag="041" ind1="0" ind2=" "><subfield code="a">cze</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-12</subfield><subfield code="a">DE-M457</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">KS 1215</subfield><subfield code="0">(DE-625)83776:</subfield><subfield code="2">rvk</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">7,41</subfield><subfield code="2">ssgn</subfield></datafield><datafield tag="100" ind1="1" ind2=" "><subfield code="a">Kreisslová, Sandra</subfield><subfield code="d">1981-</subfield><subfield code="e">Verfasser</subfield><subfield code="0">(DE-588)1050382153</subfield><subfield code="4">aut</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Konstrukce etnické identity a kolektivní paměti v biografických vyprávěních českých Němců</subfield><subfield code="b">na příkladu vzpomínek Němců na Chomutovsku</subfield><subfield code="c">Sandra Kreisslová</subfield></datafield><datafield tag="250" ind1=" " ind2=" "><subfield code="a">Vyd. 1.</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">Praha</subfield><subfield code="b">Univ. Karlova, Filozofická Fak.</subfield><subfield code="c">2013</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">194 S.</subfield><subfield code="b">Ill.</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="b">n</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="b">nc</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="490" ind1="1" ind2=" "><subfield code="a">Humanitas</subfield><subfield code="v">6</subfield></datafield><datafield tag="500" ind1=" " ind2=" "><subfield code="a">Zsfassung in dt. und engl. Sprache</subfield></datafield><datafield tag="648" ind1=" " ind2="7"><subfield code="a">Geschichte 1900-2000</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Kollektives Gedächtnis</subfield><subfield code="0">(DE-588)4200793-8</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Ethnische Identität</subfield><subfield code="0">(DE-588)4153096-2</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Sudetendeutsche</subfield><subfield code="0">(DE-588)4058386-7</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="651" ind1=" " ind2="7"><subfield code="a">Chomutov</subfield><subfield code="z">Region</subfield><subfield code="0">(DE-588)4403374-6</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="689" ind1="0" ind2="0"><subfield code="a">Chomutov</subfield><subfield code="z">Region</subfield><subfield code="0">(DE-588)4403374-6</subfield><subfield code="D">g</subfield></datafield><datafield tag="689" ind1="0" ind2="1"><subfield code="a">Sudetendeutsche</subfield><subfield code="0">(DE-588)4058386-7</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="2"><subfield code="a">Ethnische Identität</subfield><subfield code="0">(DE-588)4153096-2</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="3"><subfield code="a">Kollektives Gedächtnis</subfield><subfield code="0">(DE-588)4200793-8</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="4"><subfield code="a">Geschichte 1900-2000</subfield><subfield code="A">z</subfield></datafield><datafield tag="689" ind1="0" ind2=" "><subfield code="5">DE-604</subfield></datafield><datafield tag="830" ind1=" " ind2="0"><subfield code="a">Humanitas</subfield><subfield code="v">6</subfield><subfield code="w">(DE-604)BV036081649</subfield><subfield code="9">6</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="u">https://www.recensio.net/r/e71362ebc9e34b08a05e2b70184dc020</subfield><subfield code="y">rezensiert in: Bohemia, 56 (2016), 2, S. 518-520</subfield><subfield code="3">Rezension</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">Digitalisierung BSB Muenchen 19 - ADAM Catalogue Enrichment</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=027077875&sequence=000003&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Inhaltsverzeichnis</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">Digitalisierung BSB Muenchen 19 - ADAM Catalogue Enrichment</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=027077875&sequence=000004&line_number=0002&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Abstract</subfield></datafield><datafield tag="940" ind1="1" ind2=" "><subfield code="n">DHB</subfield></datafield><datafield tag="940" ind1="1" ind2=" "><subfield code="n">oe</subfield></datafield><datafield tag="940" ind1="1" ind2=" "><subfield code="q">DHB_BSB_DDC1</subfield></datafield><datafield tag="940" ind1="1" ind2=" "><subfield code="q">DHB_JDG_ISBN_1</subfield></datafield><datafield tag="942" ind1="1" ind2="1"><subfield code="c">900</subfield><subfield code="e">22/bsb</subfield><subfield code="f">0904</subfield><subfield code="g">4371</subfield></datafield><datafield tag="942" ind1="1" ind2="1"><subfield code="c">900</subfield><subfield code="e">22/bsb</subfield><subfield code="f">0904</subfield><subfield code="g">43</subfield></datafield><datafield tag="943" ind1="1" ind2=" "><subfield code="a">oai:aleph.bib-bvb.de:BVB01-027077875</subfield></datafield></record></collection> |
geographic | Chomutov Region (DE-588)4403374-6 gnd |
geographic_facet | Chomutov Region |
id | DE-604.BV041637004 |
illustrated | Illustrated |
indexdate | 2025-01-30T17:01:27Z |
institution | BVB |
isbn | 9788073084844 |
language | Czech |
oai_aleph_id | oai:aleph.bib-bvb.de:BVB01-027077875 |
oclc_num | 879549858 |
open_access_boolean | |
owner | DE-12 DE-M457 |
owner_facet | DE-12 DE-M457 |
physical | 194 S. Ill. |
psigel | DHB_BSB_DDC1 DHB_JDG_ISBN_1 |
publishDate | 2013 |
publishDateSearch | 2013 |
publishDateSort | 2013 |
publisher | Univ. Karlova, Filozofická Fak. |
record_format | marc |
series | Humanitas |
series2 | Humanitas |
spelling | Kreisslová, Sandra 1981- Verfasser (DE-588)1050382153 aut Konstrukce etnické identity a kolektivní paměti v biografických vyprávěních českých Němců na příkladu vzpomínek Němců na Chomutovsku Sandra Kreisslová Vyd. 1. Praha Univ. Karlova, Filozofická Fak. 2013 194 S. Ill. txt rdacontent n rdamedia nc rdacarrier Humanitas 6 Zsfassung in dt. und engl. Sprache Geschichte 1900-2000 gnd rswk-swf Kollektives Gedächtnis (DE-588)4200793-8 gnd rswk-swf Ethnische Identität (DE-588)4153096-2 gnd rswk-swf Sudetendeutsche (DE-588)4058386-7 gnd rswk-swf Chomutov Region (DE-588)4403374-6 gnd rswk-swf Chomutov Region (DE-588)4403374-6 g Sudetendeutsche (DE-588)4058386-7 s Ethnische Identität (DE-588)4153096-2 s Kollektives Gedächtnis (DE-588)4200793-8 s Geschichte 1900-2000 z DE-604 Humanitas 6 (DE-604)BV036081649 6 https://www.recensio.net/r/e71362ebc9e34b08a05e2b70184dc020 rezensiert in: Bohemia, 56 (2016), 2, S. 518-520 Rezension Digitalisierung BSB Muenchen 19 - ADAM Catalogue Enrichment application/pdf http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=027077875&sequence=000003&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA Inhaltsverzeichnis Digitalisierung BSB Muenchen 19 - ADAM Catalogue Enrichment application/pdf http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=027077875&sequence=000004&line_number=0002&func_code=DB_RECORDS&service_type=MEDIA Abstract |
spellingShingle | Kreisslová, Sandra 1981- Konstrukce etnické identity a kolektivní paměti v biografických vyprávěních českých Němců na příkladu vzpomínek Němců na Chomutovsku Humanitas Kollektives Gedächtnis (DE-588)4200793-8 gnd Ethnische Identität (DE-588)4153096-2 gnd Sudetendeutsche (DE-588)4058386-7 gnd |
subject_GND | (DE-588)4200793-8 (DE-588)4153096-2 (DE-588)4058386-7 (DE-588)4403374-6 |
title | Konstrukce etnické identity a kolektivní paměti v biografických vyprávěních českých Němců na příkladu vzpomínek Němců na Chomutovsku |
title_auth | Konstrukce etnické identity a kolektivní paměti v biografických vyprávěních českých Němců na příkladu vzpomínek Němců na Chomutovsku |
title_exact_search | Konstrukce etnické identity a kolektivní paměti v biografických vyprávěních českých Němců na příkladu vzpomínek Němců na Chomutovsku |
title_full | Konstrukce etnické identity a kolektivní paměti v biografických vyprávěních českých Němců na příkladu vzpomínek Němců na Chomutovsku Sandra Kreisslová |
title_fullStr | Konstrukce etnické identity a kolektivní paměti v biografických vyprávěních českých Němců na příkladu vzpomínek Němců na Chomutovsku Sandra Kreisslová |
title_full_unstemmed | Konstrukce etnické identity a kolektivní paměti v biografických vyprávěních českých Němců na příkladu vzpomínek Němců na Chomutovsku Sandra Kreisslová |
title_short | Konstrukce etnické identity a kolektivní paměti v biografických vyprávěních českých Němců |
title_sort | konstrukce etnicke identity a kolektivni pameti v biografickych vypravenich ceskych nemcu na prikladu vzpominek nemcu na chomutovsku |
title_sub | na příkladu vzpomínek Němců na Chomutovsku |
topic | Kollektives Gedächtnis (DE-588)4200793-8 gnd Ethnische Identität (DE-588)4153096-2 gnd Sudetendeutsche (DE-588)4058386-7 gnd |
topic_facet | Kollektives Gedächtnis Ethnische Identität Sudetendeutsche Chomutov Region |
url | https://www.recensio.net/r/e71362ebc9e34b08a05e2b70184dc020 http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=027077875&sequence=000003&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=027077875&sequence=000004&line_number=0002&func_code=DB_RECORDS&service_type=MEDIA |
volume_link | (DE-604)BV036081649 |
work_keys_str_mv | AT kreisslovasandra konstrukceetnickeidentityakolektivnipametivbiografickychvypravenichceskychnemcunaprikladuvzpomineknemcunachomutovsku |