Technology review: Newcastle disease: with special emphasis on its effect on village chickens
Gespeichert in:
| Beteiligte Personen: | , , |
|---|---|
| Format: | Buch |
| Sprache: | Englisch |
| Veröffentlicht: |
Rome
FAO
2004
|
| Schriftenreihe: | FAO animal production and health paper
161 |
| Schlagwörter: | |
| Links: | http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=024494112&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |
| Beschreibung: | Literaturverz. S. 55 - 63 |
| Umfang: | 63 S. Ill. |
| ISBN: | 9251050805 |
Internformat
MARC
| LEADER | 00000nam a2200000 cb4500 | ||
|---|---|---|---|
| 001 | BV039644266 | ||
| 003 | DE-604 | ||
| 005 | 00000000000000.0 | ||
| 007 | t| | ||
| 008 | 111018s2004 xx |||| 00||| eng d | ||
| 020 | |a 9251050805 |9 92-5-105080-5 | ||
| 035 | |a (OCoLC)918114513 | ||
| 035 | |a (DE-599)BVBBV039644266 | ||
| 040 | |a DE-604 |b ger |e rakwb | ||
| 041 | 0 | |a eng | |
| 049 | |a DE-11 | ||
| 084 | |a ZD 10200 |0 (DE-625)155484: |2 rvk | ||
| 100 | 1 | |a Alexander, D. J. |e Verfasser |4 aut | |
| 245 | 1 | 0 | |a Technology review: Newcastle disease |b with special emphasis on its effect on village chickens |c D. J. Alexander, J. G. Bell and R. G. Alders |
| 264 | 1 | |a Rome |b FAO |c 2004 | |
| 300 | |a 63 S. |e Ill. | ||
| 336 | |b txt |2 rdacontent | ||
| 337 | |b n |2 rdamedia | ||
| 338 | |b nc |2 rdacarrier | ||
| 490 | 1 | |a FAO animal production and health paper |v 161 | |
| 500 | |a Literaturverz. S. 55 - 63 | ||
| 650 | 0 | 7 | |a Huhn |0 (DE-588)4026126-8 |2 gnd |9 rswk-swf |
| 650 | 0 | 7 | |a Newcastle-Krankheit |0 (DE-588)4208244-4 |2 gnd |9 rswk-swf |
| 689 | 0 | 0 | |a Huhn |0 (DE-588)4026126-8 |D s |
| 689 | 0 | 1 | |a Newcastle-Krankheit |0 (DE-588)4208244-4 |D s |
| 689 | 0 | |5 DE-604 | |
| 700 | 1 | |a Bell, J. G. |e Verfasser |4 aut | |
| 700 | 1 | |a Alders, Robyn G. |e Verfasser |4 aut | |
| 810 | 2 | |a Food and Agriculture Organization |t FAO animal production and health paper |v 161 |w (DE-604)BV025129883 |9 161 | |
| 856 | 4 | 2 | |m HBZ Datenaustausch |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=024494112&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |3 Inhaltsverzeichnis |
| 943 | 1 | |a oai:aleph.bib-bvb.de:BVB01-024494112 | |
Datensatz im Suchindex
| _version_ | 1819281886394974208 |
|---|---|
| adam_text | Titel: Technology review: Newcastle disease
Autor: Alexander, Dennis J.
Jahr: 2004
CONTENTS
Chapter 1 1
NEWCASTLE DISEASE VIROLOGY AND EPIDEMIOLOGY
Chapter 2 13
DIAGNOSIS OF NEWCASTLE DISEASE
Chapter 3 16
VACCINATION
Chapter 4 23
NEWCASTLE DISEASE IN VILLAGE CHICKENS
BIBLIOGRAPHY 55
|
| any_adam_object | 1 |
| author | Alexander, D. J. Bell, J. G. Alders, Robyn G. |
| author_facet | Alexander, D. J. Bell, J. G. Alders, Robyn G. |
| author_role | aut aut aut |
| author_sort | Alexander, D. J. |
| author_variant | d j a dj dja j g b jg jgb r g a rg rga |
| building | Verbundindex |
| bvnumber | BV039644266 |
| classification_rvk | ZD 10200 |
| ctrlnum | (OCoLC)918114513 (DE-599)BVBBV039644266 |
| discipline | Agrar-/Forst-/Ernährungs-/Haushaltswissenschaft / Gartenbau |
| format | Book |
| fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>01623nam a2200397 cb4500</leader><controlfield tag="001">BV039644266</controlfield><controlfield tag="003">DE-604</controlfield><controlfield tag="005">00000000000000.0</controlfield><controlfield tag="007">t|</controlfield><controlfield tag="008">111018s2004 xx |||| 00||| eng d</controlfield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9251050805</subfield><subfield code="9">92-5-105080-5</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)918114513</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-599)BVBBV039644266</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-604</subfield><subfield code="b">ger</subfield><subfield code="e">rakwb</subfield></datafield><datafield tag="041" ind1="0" ind2=" "><subfield code="a">eng</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-11</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">ZD 10200</subfield><subfield code="0">(DE-625)155484:</subfield><subfield code="2">rvk</subfield></datafield><datafield tag="100" ind1="1" ind2=" "><subfield code="a">Alexander, D. J.</subfield><subfield code="e">Verfasser</subfield><subfield code="4">aut</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Technology review: Newcastle disease</subfield><subfield code="b">with special emphasis on its effect on village chickens</subfield><subfield code="c">D. J. Alexander, J. G. Bell and R. G. Alders</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">Rome</subfield><subfield code="b">FAO</subfield><subfield code="c">2004</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">63 S.</subfield><subfield code="e">Ill.</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="b">n</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="b">nc</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="490" ind1="1" ind2=" "><subfield code="a">FAO animal production and health paper</subfield><subfield code="v">161</subfield></datafield><datafield tag="500" ind1=" " ind2=" "><subfield code="a">Literaturverz. S. 55 - 63</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Huhn</subfield><subfield code="0">(DE-588)4026126-8</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Newcastle-Krankheit</subfield><subfield code="0">(DE-588)4208244-4</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="689" ind1="0" ind2="0"><subfield code="a">Huhn</subfield><subfield code="0">(DE-588)4026126-8</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="1"><subfield code="a">Newcastle-Krankheit</subfield><subfield code="0">(DE-588)4208244-4</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2=" "><subfield code="5">DE-604</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Bell, J. G.</subfield><subfield code="e">Verfasser</subfield><subfield code="4">aut</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Alders, Robyn G.</subfield><subfield code="e">Verfasser</subfield><subfield code="4">aut</subfield></datafield><datafield tag="810" ind1="2" ind2=" "><subfield code="a">Food and Agriculture Organization</subfield><subfield code="t">FAO animal production and health paper</subfield><subfield code="v">161</subfield><subfield code="w">(DE-604)BV025129883</subfield><subfield code="9">161</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">HBZ Datenaustausch</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=024494112&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Inhaltsverzeichnis</subfield></datafield><datafield tag="943" ind1="1" ind2=" "><subfield code="a">oai:aleph.bib-bvb.de:BVB01-024494112</subfield></datafield></record></collection> |
| id | DE-604.BV039644266 |
| illustrated | Not Illustrated |
| indexdate | 2024-12-20T15:59:15Z |
| institution | BVB |
| isbn | 9251050805 |
| language | English |
| oai_aleph_id | oai:aleph.bib-bvb.de:BVB01-024494112 |
| oclc_num | 918114513 |
| open_access_boolean | |
| owner | DE-11 |
| owner_facet | DE-11 |
| physical | 63 S. Ill. |
| publishDate | 2004 |
| publishDateSearch | 2004 |
| publishDateSort | 2004 |
| publisher | FAO |
| record_format | marc |
| series2 | FAO animal production and health paper |
| spellingShingle | Alexander, D. J. Bell, J. G. Alders, Robyn G. Technology review: Newcastle disease with special emphasis on its effect on village chickens Huhn (DE-588)4026126-8 gnd Newcastle-Krankheit (DE-588)4208244-4 gnd |
| subject_GND | (DE-588)4026126-8 (DE-588)4208244-4 |
| title | Technology review: Newcastle disease with special emphasis on its effect on village chickens |
| title_auth | Technology review: Newcastle disease with special emphasis on its effect on village chickens |
| title_exact_search | Technology review: Newcastle disease with special emphasis on its effect on village chickens |
| title_full | Technology review: Newcastle disease with special emphasis on its effect on village chickens D. J. Alexander, J. G. Bell and R. G. Alders |
| title_fullStr | Technology review: Newcastle disease with special emphasis on its effect on village chickens D. J. Alexander, J. G. Bell and R. G. Alders |
| title_full_unstemmed | Technology review: Newcastle disease with special emphasis on its effect on village chickens D. J. Alexander, J. G. Bell and R. G. Alders |
| title_short | Technology review: Newcastle disease |
| title_sort | technology review newcastle disease with special emphasis on its effect on village chickens |
| title_sub | with special emphasis on its effect on village chickens |
| topic | Huhn (DE-588)4026126-8 gnd Newcastle-Krankheit (DE-588)4208244-4 gnd |
| topic_facet | Huhn Newcastle-Krankheit |
| url | http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=024494112&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |
| volume_link | (DE-604)BV025129883 |
| work_keys_str_mv | AT alexanderdj technologyreviewnewcastlediseasewithspecialemphasisonitseffectonvillagechickens AT belljg technologyreviewnewcastlediseasewithspecialemphasisonitseffectonvillagechickens AT aldersrobyng technologyreviewnewcastlediseasewithspecialemphasisonitseffectonvillagechickens |