The semantics of dynamic space in French: descriptive, experimental and formal studies on motion expression
Gespeichert in:
| Weitere beteiligte Personen: | , |
|---|---|
| Format: | Buch |
| Sprache: | Englisch |
| Veröffentlicht: |
Amsterdam ; Philadelphia
John Benjamins Publishing Company
[2019]
|
| Schriftenreihe: | Human cognitive processing
volume 66 |
| Schlagwörter: | |
| Links: | http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=031528330&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=031528330&sequence=000003&line_number=0002&func_code=DB_RECORDS&service_type=MEDIA |
| Beschreibung: | Includes bibliographical references and index |
| Umfang: | VIII, 396 Seiten Diagramme |
| ISBN: | 9789027203205 |
Internformat
MARC
| LEADER | 00000nam a2200000 cb4500 | ||
|---|---|---|---|
| 001 | BV046148152 | ||
| 003 | DE-604 | ||
| 005 | 20191216 | ||
| 007 | t| | ||
| 008 | 190906s2019 ne |||| |||| 00||| eng d | ||
| 020 | |a 9789027203205 |c (hbk.) |9 978-90-272-0320-5 | ||
| 024 | 3 | |a 9789027203205 | |
| 035 | |a (OCoLC)1124801346 | ||
| 035 | |a (DE-599)KXP1663043191 | ||
| 040 | |a DE-604 |b ger |e rda | ||
| 041 | 0 | |a eng | |
| 044 | |a ne |c XA-NL | ||
| 049 | |a DE-739 |a DE-12 | ||
| 050 | 0 | |a PC2585 | |
| 082 | 0 | |a 445 | |
| 084 | |a ID 7040 |0 (DE-625)54873: |2 rvk | ||
| 245 | 1 | 0 | |a The semantics of dynamic space in French |b descriptive, experimental and formal studies on motion expression |c edited by Michel Aurnague (Dejan Stosic, Université de Toulouse-CNRS) |
| 264 | 1 | |a Amsterdam ; Philadelphia |b John Benjamins Publishing Company |c [2019] | |
| 300 | |a VIII, 396 Seiten |b Diagramme | ||
| 336 | |b txt |2 rdacontent | ||
| 337 | |b n |2 rdamedia | ||
| 338 | |b nc |2 rdacarrier | ||
| 490 | 1 | |a Human cognitive processing |v volume 66 | |
| 500 | |a Includes bibliographical references and index | ||
| 650 | 0 | 7 | |a Bewegungsverb |0 (DE-588)4145163-6 |2 gnd |9 rswk-swf |
| 650 | 0 | 7 | |a Französisch |0 (DE-588)4113615-9 |2 gnd |9 rswk-swf |
| 650 | 0 | 7 | |a Semantik |0 (DE-588)4054490-4 |2 gnd |9 rswk-swf |
| 653 | 0 | |a French language / Semantics | |
| 653 | 0 | |a Motion in language | |
| 655 | 7 | |0 (DE-588)4143413-4 |a Aufsatzsammlung |2 gnd-content | |
| 689 | 0 | 0 | |a Französisch |0 (DE-588)4113615-9 |D s |
| 689 | 0 | 1 | |a Semantik |0 (DE-588)4054490-4 |D s |
| 689 | 0 | 2 | |a Bewegungsverb |0 (DE-588)4145163-6 |D s |
| 689 | 0 | |5 DE-604 | |
| 700 | 1 | |a Aurnague, Michel |d 1963- |0 (DE-588)1193218195 |4 edt | |
| 700 | 1 | |a Stosic, Dejan |0 (DE-588)1029533091 |4 edt | |
| 776 | 0 | 8 | |i Erscheint auch als |n Online-Ausgabe |z 978-90-272-6250-9 |
| 830 | 0 | |a Human cognitive processing |v volume 66 |w (DE-604)BV012222977 |9 66 | |
| 856 | 4 | 2 | |m Digitalisierung UB Passau - ADAM Catalogue Enrichment |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=031528330&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |3 Inhaltsverzeichnis |
| 856 | 4 | 2 | |m Digitalisierung UB Passau - ADAM Catalogue Enrichment |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=031528330&sequence=000003&line_number=0002&func_code=DB_RECORDS&service_type=MEDIA |3 Klappentext |
| 943 | 1 | |a oai:aleph.bib-bvb.de:BVB01-031528330 | |
Datensatz im Suchindex
| _version_ | 1819266009964478464 |
|---|---|
| adam_text | Table of contents Contributors Acknowledgments Recent advances in the study of motion in French: A survey Michel Aurnague and Dejan Stosie VII ix і Part I. Arguments, modifiers, asymmetry of motion About asymmetry of motion in French: Some properties and a principle Michel Aurnague 31 French motion verbs: Insights into the status of locative PPs Laure Sarda 67 From il s’envole hors to il sort du nid: A typological change in French motion expressions Benjamin Fagard 109 Part II. Manner of motion and fictive motion Manner as a cluster concept: What does lexical coding of manner of motion tell us about manner? Dejan Stosie 141 Motion verbs and evaluative morphology Dejan Stosie and Dany Amiot 179 Fictive motion in French: Where do the data lead? Fabien Cappelli 217
vi The Semantics of Dynamic Space in French Part III. Psycholinguistic issues Casting an eye on motion events: Eye tracking and its implications for linguistic typology 249 Efstathia Sorolt, Maya Hickmann and Henriette Hendriks Structure of French expression of motion: Gesture-speech relation, between-language comparison and developmental perspective 289 Katerina Fibigerova and Michèle Guidetti Part IV. Formal and computational aspects of motion-based narrations A computational account of virtual travelers in the Montagovian generative lexicon 323 Anais Lefeuvre-Halflermeyer, Richard Moot and Christian Retoré Geoparsing and geocoding places in a dynamic space context: The case of hiking descriptions 353 Mauro Gaio and Ludovic Monda Subject Index 387
Research on the semantics of spatial markers in French is known mainly through Vandeloise’s (1986, 1991) work on static prepositions. However, interest in the expression of space in French goes back to the mid-1970s and focused first on verbs denoting changes in space, whose syntactic properties were related to specific semantic distinctions, such as the opposition between “movement” and “displacement”. This volume provides an overview of recent studies on the semantics of dynamic space in French and addresses important questions about motion expression, among which “goal bias” and asymmetry of motion, the status of locative PPs, the expression of manner, fictive or non-actual motion. Descriptive, experimental and formal or computational analyses are presented, providing complementary perspectives on the main issue. The volume is intended for researchers and advanced students wishing to learn about both spatial semantics in French and recent debates on the representation of motion events in language and cognition.
|
| any_adam_object | 1 |
| author2 | Aurnague, Michel 1963- Stosic, Dejan |
| author2_role | edt edt |
| author2_variant | m a ma d s ds |
| author_GND | (DE-588)1193218195 (DE-588)1029533091 |
| author_facet | Aurnague, Michel 1963- Stosic, Dejan |
| building | Verbundindex |
| bvnumber | BV046148152 |
| callnumber-first | P - Language and Literature |
| callnumber-label | PC2585 |
| callnumber-raw | PC2585 |
| callnumber-search | PC2585 |
| callnumber-sort | PC 42585 |
| callnumber-subject | PC - Romanic Languages |
| classification_rvk | ID 7040 |
| ctrlnum | (OCoLC)1124801346 (DE-599)KXP1663043191 |
| dewey-full | 445 |
| dewey-hundreds | 400 - Language |
| dewey-ones | 445 - Grammar of standard French |
| dewey-raw | 445 |
| dewey-search | 445 |
| dewey-sort | 3445 |
| dewey-tens | 440 - French & related Romance languages |
| discipline | Romanistik |
| format | Book |
| fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>02434nam a2200517 cb4500</leader><controlfield tag="001">BV046148152</controlfield><controlfield tag="003">DE-604</controlfield><controlfield tag="005">20191216 </controlfield><controlfield tag="007">t|</controlfield><controlfield tag="008">190906s2019 ne |||| |||| 00||| eng d</controlfield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9789027203205</subfield><subfield code="c">(hbk.)</subfield><subfield code="9">978-90-272-0320-5</subfield></datafield><datafield tag="024" ind1="3" ind2=" "><subfield code="a">9789027203205</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)1124801346</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-599)KXP1663043191</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-604</subfield><subfield code="b">ger</subfield><subfield code="e">rda</subfield></datafield><datafield tag="041" ind1="0" ind2=" "><subfield code="a">eng</subfield></datafield><datafield tag="044" ind1=" " ind2=" "><subfield code="a">ne</subfield><subfield code="c">XA-NL</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-739</subfield><subfield code="a">DE-12</subfield></datafield><datafield tag="050" ind1=" " ind2="0"><subfield code="a">PC2585</subfield></datafield><datafield tag="082" ind1="0" ind2=" "><subfield code="a">445</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">ID 7040</subfield><subfield code="0">(DE-625)54873:</subfield><subfield code="2">rvk</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">The semantics of dynamic space in French</subfield><subfield code="b">descriptive, experimental and formal studies on motion expression</subfield><subfield code="c">edited by Michel Aurnague (Dejan Stosic, Université de Toulouse-CNRS)</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">Amsterdam ; Philadelphia</subfield><subfield code="b">John Benjamins Publishing Company</subfield><subfield code="c">[2019]</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">VIII, 396 Seiten</subfield><subfield code="b">Diagramme</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="b">n</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="b">nc</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="490" ind1="1" ind2=" "><subfield code="a">Human cognitive processing</subfield><subfield code="v">volume 66</subfield></datafield><datafield tag="500" ind1=" " ind2=" "><subfield code="a">Includes bibliographical references and index</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Bewegungsverb</subfield><subfield code="0">(DE-588)4145163-6</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Französisch</subfield><subfield code="0">(DE-588)4113615-9</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Semantik</subfield><subfield code="0">(DE-588)4054490-4</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="653" ind1=" " ind2="0"><subfield code="a">French language / Semantics</subfield></datafield><datafield tag="653" ind1=" " ind2="0"><subfield code="a">Motion in language</subfield></datafield><datafield tag="655" ind1=" " ind2="7"><subfield code="0">(DE-588)4143413-4</subfield><subfield code="a">Aufsatzsammlung</subfield><subfield code="2">gnd-content</subfield></datafield><datafield tag="689" ind1="0" ind2="0"><subfield code="a">Französisch</subfield><subfield code="0">(DE-588)4113615-9</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="1"><subfield code="a">Semantik</subfield><subfield code="0">(DE-588)4054490-4</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="2"><subfield code="a">Bewegungsverb</subfield><subfield code="0">(DE-588)4145163-6</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2=" "><subfield code="5">DE-604</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Aurnague, Michel</subfield><subfield code="d">1963-</subfield><subfield code="0">(DE-588)1193218195</subfield><subfield code="4">edt</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Stosic, Dejan</subfield><subfield code="0">(DE-588)1029533091</subfield><subfield code="4">edt</subfield></datafield><datafield tag="776" ind1="0" ind2="8"><subfield code="i">Erscheint auch als</subfield><subfield code="n">Online-Ausgabe</subfield><subfield code="z">978-90-272-6250-9</subfield></datafield><datafield tag="830" ind1=" " ind2="0"><subfield code="a">Human cognitive processing</subfield><subfield code="v">volume 66</subfield><subfield code="w">(DE-604)BV012222977</subfield><subfield code="9">66</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">Digitalisierung UB Passau - ADAM Catalogue Enrichment</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=031528330&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Inhaltsverzeichnis</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">Digitalisierung UB Passau - ADAM Catalogue Enrichment</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=031528330&sequence=000003&line_number=0002&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Klappentext</subfield></datafield><datafield tag="943" ind1="1" ind2=" "><subfield code="a">oai:aleph.bib-bvb.de:BVB01-031528330</subfield></datafield></record></collection> |
| genre | (DE-588)4143413-4 Aufsatzsammlung gnd-content |
| genre_facet | Aufsatzsammlung |
| id | DE-604.BV046148152 |
| illustrated | Not Illustrated |
| indexdate | 2024-12-20T18:44:24Z |
| institution | BVB |
| isbn | 9789027203205 |
| language | English |
| oai_aleph_id | oai:aleph.bib-bvb.de:BVB01-031528330 |
| oclc_num | 1124801346 |
| open_access_boolean | |
| owner | DE-739 DE-12 |
| owner_facet | DE-739 DE-12 |
| physical | VIII, 396 Seiten Diagramme |
| publishDate | 2019 |
| publishDateSearch | 2019 |
| publishDateSort | 2019 |
| publisher | John Benjamins Publishing Company |
| record_format | marc |
| series | Human cognitive processing |
| series2 | Human cognitive processing |
| spellingShingle | The semantics of dynamic space in French descriptive, experimental and formal studies on motion expression Human cognitive processing Bewegungsverb (DE-588)4145163-6 gnd Französisch (DE-588)4113615-9 gnd Semantik (DE-588)4054490-4 gnd |
| subject_GND | (DE-588)4145163-6 (DE-588)4113615-9 (DE-588)4054490-4 (DE-588)4143413-4 |
| title | The semantics of dynamic space in French descriptive, experimental and formal studies on motion expression |
| title_auth | The semantics of dynamic space in French descriptive, experimental and formal studies on motion expression |
| title_exact_search | The semantics of dynamic space in French descriptive, experimental and formal studies on motion expression |
| title_full | The semantics of dynamic space in French descriptive, experimental and formal studies on motion expression edited by Michel Aurnague (Dejan Stosic, Université de Toulouse-CNRS) |
| title_fullStr | The semantics of dynamic space in French descriptive, experimental and formal studies on motion expression edited by Michel Aurnague (Dejan Stosic, Université de Toulouse-CNRS) |
| title_full_unstemmed | The semantics of dynamic space in French descriptive, experimental and formal studies on motion expression edited by Michel Aurnague (Dejan Stosic, Université de Toulouse-CNRS) |
| title_short | The semantics of dynamic space in French |
| title_sort | the semantics of dynamic space in french descriptive experimental and formal studies on motion expression |
| title_sub | descriptive, experimental and formal studies on motion expression |
| topic | Bewegungsverb (DE-588)4145163-6 gnd Französisch (DE-588)4113615-9 gnd Semantik (DE-588)4054490-4 gnd |
| topic_facet | Bewegungsverb Französisch Semantik Aufsatzsammlung |
| url | http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=031528330&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=031528330&sequence=000003&line_number=0002&func_code=DB_RECORDS&service_type=MEDIA |
| volume_link | (DE-604)BV012222977 |
| work_keys_str_mv | AT aurnaguemichel thesemanticsofdynamicspaceinfrenchdescriptiveexperimentalandformalstudiesonmotionexpression AT stosicdejan thesemanticsofdynamicspaceinfrenchdescriptiveexperimentalandformalstudiesonmotionexpression |