The Book of noble character: critical edition of Makārim al-akhlāq wa-maḥāsin al-ādāb wa-badāʾiʿ al-awṣāf wa-gharāʾib al-tashbīhāt : attributed to Abū Manṣūr al-Thaʿālibī (d. 429/1039)
Gespeichert in:
| Beteilige Person: | |
|---|---|
| Weitere beteiligte Personen: | , |
| Format: | Buch |
| Sprache: | Englisch Arabisch |
| Veröffentlicht: |
Leiden ; Boston
Brill
[2015]
|
| Schriftenreihe: | Islamic history and civilization
volume 120 |
| Schlagwörter: | |
| Links: | http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=029414793&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |
| Umfang: | 26, 297 Seiten Faksimiles 25 cm |
| ISBN: | 9004300910 9789004300910 |
Internformat
MARC
| LEADER | 00000nam a2200000 cb4500 | ||
|---|---|---|---|
| 001 | BV044007000 | ||
| 003 | DE-604 | ||
| 005 | 20220518 | ||
| 007 | t| | ||
| 008 | 170120s2015 xx |||| |||| 00||| eng d | ||
| 020 | |a 9004300910 |c hardback |9 90-04-30091-0 | ||
| 020 | |a 9789004300910 |c : hardback |9 978-90-04-30091-0 | ||
| 035 | |a (OCoLC)919192085 | ||
| 035 | |a (DE-599)GBV84236871X | ||
| 040 | |a DE-604 |b ger |e rda | ||
| 041 | 0 | |a eng |a ara | |
| 049 | |a DE-29 |a DE-473 |a DE-20 |a DE-19 |a DE-355 | ||
| 050 | 0 | |a BJ1291 | |
| 082 | 0 | |a 800 | |
| 084 | |a EN 3208 |0 (DE-625)25375:11776 |2 rvk | ||
| 100 | 1 | |a Ṯaʿālibī, ʿAbd-al-Malik Ibn-Muḥammad aṯ- |d 961-1038 |e Verfasser |0 (DE-588)118906569 |4 aut | |
| 245 | 1 | 0 | |a The Book of noble character |b critical edition of Makārim al-akhlāq wa-maḥāsin al-ādāb wa-badāʾiʿ al-awṣāf wa-gharāʾib al-tashbīhāt : attributed to Abū Manṣūr al-Thaʿālibī (d. 429/1039) |c by Bilal Orfali, Ramzi Baalbaki |
| 246 | 1 | 3 | |a Makārim al-aḫlāq wa-maḥāsin al-ādāb wa-badāʾiʿ al-auṣāf wa-ġarāʾib al-tašbīhāt |
| 264 | 1 | |a Leiden ; Boston |b Brill |c [2015] | |
| 300 | |a 26, 297 Seiten |b Faksimiles |c 25 cm | ||
| 336 | |b txt |2 rdacontent | ||
| 337 | |b n |2 rdamedia | ||
| 338 | |b nc |2 rdacarrier | ||
| 490 | 1 | |a Islamic history and civilization |v volume 120 | |
| 520 | 1 | |a This critical Arabic text edition of K. Makarim al-akhlaq wa-mahasin al-adab wa-bada'i' al-awsaf wa-ghara'ib al-tashbihat(Book of Noble Character, Excellent Conduct, Admirable Descriptions, and Curious Similes) is a substantial work of adab attributed to the prominent littérateur Abu Mansur al-Tha'alibi (d. 429/1039) that consists of a short introduction and three chapters. The first chapter addresses acquiring noble character and excellent conduct (al-tahalli bi-makarim al-akhlaq wa-mahasin al-adab); the second addresses shunning away from base character and ugly traits (al-tazakki 'an masawi' al-akhlaq wa-maqabih al-shiyam); and the third addresses admirable descriptions and curious similes (bada'i' al-awsaf wa-ghara'ib al-tashbihat). At the end of the text one finds a relatively large collection of widely circulating proverbs (amthal sa'ira) that are alphabetically arranged. Makarim al-akhlaq is in essence an anthology of "good conduct"; and of quotations suitable for social and literary discourse. It reflects the three ingredients of adab: behavior, literary culture, and learning. The work is introduced by an analytical study discussing the attribution of the work, the related genres, and the unique manuscript of the text | |
| 546 | |a In arabischer Schrift | ||
| 546 | |a Text arabisch, Einleitung englisch | ||
| 650 | 0 | 7 | |a Ethik |0 (DE-588)4015602-3 |2 gnd |9 rswk-swf |
| 650 | 0 | 7 | |a Moral |0 (DE-588)4040222-8 |2 gnd |9 rswk-swf |
| 650 | 0 | 7 | |a Islam |0 (DE-588)4027743-4 |2 gnd |9 rswk-swf |
| 655 | 7 | |8 1\p |0 (DE-588)4135952-5 |a Quelle |2 gnd-content | |
| 689 | 0 | 0 | |a Islam |0 (DE-588)4027743-4 |D s |
| 689 | 0 | 1 | |a Ethik |0 (DE-588)4015602-3 |D s |
| 689 | 0 | 2 | |a Moral |0 (DE-588)4040222-8 |D s |
| 689 | 0 | |5 DE-604 | |
| 700 | 1 | |a Orfali, Bilal |d 1980- |0 (DE-588)140143777 |4 edt | |
| 700 | 1 | |a Baʿlabakkī, Ramzī Munīr |d 1951- |0 (DE-588)103111937X |4 edt | |
| 776 | 0 | 8 | |i Erscheint auch als |n Online-Ausgabe |z 978-90-04-30093-4 |
| 830 | 0 | |a Islamic history and civilization |v volume 120 |w (DE-604)BV008939081 |9 120 | |
| 856 | 4 | 2 | |m Digitalisierung UB Regensburg - ADAM Catalogue Enrichment |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=029414793&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |3 Klappentext |
| 883 | 1 | |8 1\p |a cgwrk |d 20201028 |q DE-101 |u https://d-nb.info/provenance/plan#cgwrk | |
| 943 | 1 | |a oai:aleph.bib-bvb.de:BVB01-029414793 | |
Datensatz im Suchindex
| _version_ | 1819244474426982400 |
|---|---|
| adam_text | This critical Arabic text edition of K. Makārim alakhlãq wa-mahãsin al-ādāb wa-badāTal-awşăfwagharďib al-tashbīhāt (Book ofNoble Character, Excellent Conduct, Admirable Descriptions, and Curious Similes) is a substantial work of adab attrib uted to the prominent littérateur Abu Mansur alTha ālibī (d. 429/1039) that consists of a short intro duction and three chapters. The first chapter addresses acquiring noble character and excellent conduct (al-tahallī bi-makārim al-akhlãq wamahãsin al-ādāb)·, the second addresses shunning away from base character and ugly traits (al-tazakki ‘an masäwľ al-akhlãq wa֊maqābih al-shiyam); and the third addresses admirable descriptions and curious similes {badä’ľal-awşâfwa-ghara’ib altashbihāt). At the end of the text one finds a rela tively large collection of widely circulating proverbs (amthāl sā’ira) that are alphabetically arranged. Makãrím al-akhlãq is in essence an anthology of “good conduct” and of quotations suitable for social and literary discourse. It reflects the three ingredi ents of adab: behavior, literary culture, and learn ing. The work is introduced by an analytical study discussing the attribution of the work, the related genres, and the unique manuscript of the text.
|
| any_adam_object | 1 |
| author | Ṯaʿālibī, ʿAbd-al-Malik Ibn-Muḥammad aṯ- 961-1038 |
| author2 | Orfali, Bilal 1980- Baʿlabakkī, Ramzī Munīr 1951- |
| author2_role | edt edt |
| author2_variant | b o bo r m b rm rmb |
| author_GND | (DE-588)118906569 (DE-588)140143777 (DE-588)103111937X |
| author_facet | Ṯaʿālibī, ʿAbd-al-Malik Ibn-Muḥammad aṯ- 961-1038 Orfali, Bilal 1980- Baʿlabakkī, Ramzī Munīr 1951- |
| author_role | aut |
| author_sort | Ṯaʿālibī, ʿAbd-al-Malik Ibn-Muḥammad aṯ- 961-1038 |
| author_variant | ʿ a i m a ṯ ʿaima ʿaimaṯ |
| building | Verbundindex |
| bvnumber | BV044007000 |
| callnumber-first | B - Philosophy, Psychology, Religion |
| callnumber-label | BJ1291 |
| callnumber-raw | BJ1291 |
| callnumber-search | BJ1291 |
| callnumber-sort | BJ 41291 |
| callnumber-subject | BJ - Ethics |
| classification_rvk | EN 3208 |
| ctrlnum | (OCoLC)919192085 (DE-599)GBV84236871X |
| dewey-full | 800 |
| dewey-hundreds | 800 - Literature (Belles-lettres) and rhetoric |
| dewey-ones | 800 - Literature (Belles-lettres) and rhetoric |
| dewey-raw | 800 |
| dewey-search | 800 |
| dewey-sort | 3800 |
| dewey-tens | 800 - Literature (Belles-lettres) and rhetoric |
| discipline | Außereuropäische Sprachen und Literaturen Literaturwissenschaft |
| format | Book |
| fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>03736nam a2200529 cb4500</leader><controlfield tag="001">BV044007000</controlfield><controlfield tag="003">DE-604</controlfield><controlfield tag="005">20220518 </controlfield><controlfield tag="007">t|</controlfield><controlfield tag="008">170120s2015 xx |||| |||| 00||| eng d</controlfield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9004300910</subfield><subfield code="c">hardback</subfield><subfield code="9">90-04-30091-0</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9789004300910</subfield><subfield code="c">: hardback</subfield><subfield code="9">978-90-04-30091-0</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)919192085</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-599)GBV84236871X</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-604</subfield><subfield code="b">ger</subfield><subfield code="e">rda</subfield></datafield><datafield tag="041" ind1="0" ind2=" "><subfield code="a">eng</subfield><subfield code="a">ara</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-29</subfield><subfield code="a">DE-473</subfield><subfield code="a">DE-20</subfield><subfield code="a">DE-19</subfield><subfield code="a">DE-355</subfield></datafield><datafield tag="050" ind1=" " ind2="0"><subfield code="a">BJ1291</subfield></datafield><datafield tag="082" ind1="0" ind2=" "><subfield code="a">800</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">EN 3208</subfield><subfield code="0">(DE-625)25375:11776</subfield><subfield code="2">rvk</subfield></datafield><datafield tag="100" ind1="1" ind2=" "><subfield code="a">Ṯaʿālibī, ʿAbd-al-Malik Ibn-Muḥammad aṯ-</subfield><subfield code="d">961-1038</subfield><subfield code="e">Verfasser</subfield><subfield code="0">(DE-588)118906569</subfield><subfield code="4">aut</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">The Book of noble character</subfield><subfield code="b">critical edition of Makārim al-akhlāq wa-maḥāsin al-ādāb wa-badāʾiʿ al-awṣāf wa-gharāʾib al-tashbīhāt : attributed to Abū Manṣūr al-Thaʿālibī (d. 429/1039)</subfield><subfield code="c">by Bilal Orfali, Ramzi Baalbaki</subfield></datafield><datafield tag="246" ind1="1" ind2="3"><subfield code="a">Makārim al-aḫlāq wa-maḥāsin al-ādāb wa-badāʾiʿ al-auṣāf wa-ġarāʾib al-tašbīhāt</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">Leiden ; Boston</subfield><subfield code="b">Brill</subfield><subfield code="c">[2015]</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">26, 297 Seiten</subfield><subfield code="b">Faksimiles</subfield><subfield code="c">25 cm</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="b">n</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="b">nc</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="490" ind1="1" ind2=" "><subfield code="a">Islamic history and civilization</subfield><subfield code="v">volume 120</subfield></datafield><datafield tag="520" ind1="1" ind2=" "><subfield code="a">This critical Arabic text edition of K. Makarim al-akhlaq wa-mahasin al-adab wa-bada'i' al-awsaf wa-ghara'ib al-tashbihat(Book of Noble Character, Excellent Conduct, Admirable Descriptions, and Curious Similes) is a substantial work of adab attributed to the prominent littérateur Abu Mansur al-Tha'alibi (d. 429/1039) that consists of a short introduction and three chapters. The first chapter addresses acquiring noble character and excellent conduct (al-tahalli bi-makarim al-akhlaq wa-mahasin al-adab); the second addresses shunning away from base character and ugly traits (al-tazakki 'an masawi' al-akhlaq wa-maqabih al-shiyam); and the third addresses admirable descriptions and curious similes (bada'i' al-awsaf wa-ghara'ib al-tashbihat). At the end of the text one finds a relatively large collection of widely circulating proverbs (amthal sa'ira) that are alphabetically arranged. Makarim al-akhlaq is in essence an anthology of "good conduct"; and of quotations suitable for social and literary discourse. It reflects the three ingredients of adab: behavior, literary culture, and learning. The work is introduced by an analytical study discussing the attribution of the work, the related genres, and the unique manuscript of the text</subfield></datafield><datafield tag="546" ind1=" " ind2=" "><subfield code="a">In arabischer Schrift</subfield></datafield><datafield tag="546" ind1=" " ind2=" "><subfield code="a">Text arabisch, Einleitung englisch</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Ethik</subfield><subfield code="0">(DE-588)4015602-3</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Moral</subfield><subfield code="0">(DE-588)4040222-8</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Islam</subfield><subfield code="0">(DE-588)4027743-4</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="655" ind1=" " ind2="7"><subfield code="8">1\p</subfield><subfield code="0">(DE-588)4135952-5</subfield><subfield code="a">Quelle</subfield><subfield code="2">gnd-content</subfield></datafield><datafield tag="689" ind1="0" ind2="0"><subfield code="a">Islam</subfield><subfield code="0">(DE-588)4027743-4</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="1"><subfield code="a">Ethik</subfield><subfield code="0">(DE-588)4015602-3</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="2"><subfield code="a">Moral</subfield><subfield code="0">(DE-588)4040222-8</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2=" "><subfield code="5">DE-604</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Orfali, Bilal</subfield><subfield code="d">1980-</subfield><subfield code="0">(DE-588)140143777</subfield><subfield code="4">edt</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Baʿlabakkī, Ramzī Munīr</subfield><subfield code="d">1951-</subfield><subfield code="0">(DE-588)103111937X</subfield><subfield code="4">edt</subfield></datafield><datafield tag="776" ind1="0" ind2="8"><subfield code="i">Erscheint auch als</subfield><subfield code="n">Online-Ausgabe</subfield><subfield code="z">978-90-04-30093-4</subfield></datafield><datafield tag="830" ind1=" " ind2="0"><subfield code="a">Islamic history and civilization</subfield><subfield code="v">volume 120</subfield><subfield code="w">(DE-604)BV008939081</subfield><subfield code="9">120</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">Digitalisierung UB Regensburg - ADAM Catalogue Enrichment</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=029414793&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Klappentext</subfield></datafield><datafield tag="883" ind1="1" ind2=" "><subfield code="8">1\p</subfield><subfield code="a">cgwrk</subfield><subfield code="d">20201028</subfield><subfield code="q">DE-101</subfield><subfield code="u">https://d-nb.info/provenance/plan#cgwrk</subfield></datafield><datafield tag="943" ind1="1" ind2=" "><subfield code="a">oai:aleph.bib-bvb.de:BVB01-029414793</subfield></datafield></record></collection> |
| genre | 1\p (DE-588)4135952-5 Quelle gnd-content |
| genre_facet | Quelle |
| id | DE-604.BV044007000 |
| illustrated | Not Illustrated |
| indexdate | 2024-12-20T17:51:06Z |
| institution | BVB |
| isbn | 9004300910 9789004300910 |
| language | English Arabic |
| oai_aleph_id | oai:aleph.bib-bvb.de:BVB01-029414793 |
| oclc_num | 919192085 |
| open_access_boolean | |
| owner | DE-29 DE-473 DE-BY-UBG DE-20 DE-19 DE-BY-UBM DE-355 DE-BY-UBR |
| owner_facet | DE-29 DE-473 DE-BY-UBG DE-20 DE-19 DE-BY-UBM DE-355 DE-BY-UBR |
| physical | 26, 297 Seiten Faksimiles 25 cm |
| publishDate | 2015 |
| publishDateSearch | 2015 |
| publishDateSort | 2015 |
| publisher | Brill |
| record_format | marc |
| series | Islamic history and civilization |
| series2 | Islamic history and civilization |
| spellingShingle | Ṯaʿālibī, ʿAbd-al-Malik Ibn-Muḥammad aṯ- 961-1038 The Book of noble character critical edition of Makārim al-akhlāq wa-maḥāsin al-ādāb wa-badāʾiʿ al-awṣāf wa-gharāʾib al-tashbīhāt : attributed to Abū Manṣūr al-Thaʿālibī (d. 429/1039) Islamic history and civilization Ethik (DE-588)4015602-3 gnd Moral (DE-588)4040222-8 gnd Islam (DE-588)4027743-4 gnd |
| subject_GND | (DE-588)4015602-3 (DE-588)4040222-8 (DE-588)4027743-4 (DE-588)4135952-5 |
| title | The Book of noble character critical edition of Makārim al-akhlāq wa-maḥāsin al-ādāb wa-badāʾiʿ al-awṣāf wa-gharāʾib al-tashbīhāt : attributed to Abū Manṣūr al-Thaʿālibī (d. 429/1039) |
| title_alt | Makārim al-aḫlāq wa-maḥāsin al-ādāb wa-badāʾiʿ al-auṣāf wa-ġarāʾib al-tašbīhāt |
| title_auth | The Book of noble character critical edition of Makārim al-akhlāq wa-maḥāsin al-ādāb wa-badāʾiʿ al-awṣāf wa-gharāʾib al-tashbīhāt : attributed to Abū Manṣūr al-Thaʿālibī (d. 429/1039) |
| title_exact_search | The Book of noble character critical edition of Makārim al-akhlāq wa-maḥāsin al-ādāb wa-badāʾiʿ al-awṣāf wa-gharāʾib al-tashbīhāt : attributed to Abū Manṣūr al-Thaʿālibī (d. 429/1039) |
| title_full | The Book of noble character critical edition of Makārim al-akhlāq wa-maḥāsin al-ādāb wa-badāʾiʿ al-awṣāf wa-gharāʾib al-tashbīhāt : attributed to Abū Manṣūr al-Thaʿālibī (d. 429/1039) by Bilal Orfali, Ramzi Baalbaki |
| title_fullStr | The Book of noble character critical edition of Makārim al-akhlāq wa-maḥāsin al-ādāb wa-badāʾiʿ al-awṣāf wa-gharāʾib al-tashbīhāt : attributed to Abū Manṣūr al-Thaʿālibī (d. 429/1039) by Bilal Orfali, Ramzi Baalbaki |
| title_full_unstemmed | The Book of noble character critical edition of Makārim al-akhlāq wa-maḥāsin al-ādāb wa-badāʾiʿ al-awṣāf wa-gharāʾib al-tashbīhāt : attributed to Abū Manṣūr al-Thaʿālibī (d. 429/1039) by Bilal Orfali, Ramzi Baalbaki |
| title_short | The Book of noble character |
| title_sort | the book of noble character critical edition of makarim al akhlaq wa mahasin al adab wa badaʾiʿ al awsaf wa gharaʾib al tashbihat attributed to abu mansur al thaʿalibi d 429 1039 |
| title_sub | critical edition of Makārim al-akhlāq wa-maḥāsin al-ādāb wa-badāʾiʿ al-awṣāf wa-gharāʾib al-tashbīhāt : attributed to Abū Manṣūr al-Thaʿālibī (d. 429/1039) |
| topic | Ethik (DE-588)4015602-3 gnd Moral (DE-588)4040222-8 gnd Islam (DE-588)4027743-4 gnd |
| topic_facet | Ethik Moral Islam Quelle |
| url | http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=029414793&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |
| volume_link | (DE-604)BV008939081 |
| work_keys_str_mv | AT taʿalibiʿabdalmalikibnmuhammadat thebookofnoblecharactercriticaleditionofmakarimalakhlaqwamahasinaladabwabadaʾiʿalawsafwagharaʾibaltashbihatattributedtoabumansuralthaʿalibid4291039 AT orfalibilal thebookofnoblecharactercriticaleditionofmakarimalakhlaqwamahasinaladabwabadaʾiʿalawsafwagharaʾibaltashbihatattributedtoabumansuralthaʿalibid4291039 AT baʿlabakkiramzimunir thebookofnoblecharactercriticaleditionofmakarimalakhlaqwamahasinaladabwabadaʾiʿalawsafwagharaʾibaltashbihatattributedtoabumansuralthaʿalibid4291039 AT taʿalibiʿabdalmalikibnmuhammadat makarimalahlaqwamahasinaladabwabadaʾiʿalausafwagaraʾibaltasbihat AT orfalibilal makarimalahlaqwamahasinaladabwabadaʾiʿalausafwagaraʾibaltasbihat AT baʿlabakkiramzimunir makarimalahlaqwamahasinaladabwabadaʾiʿalausafwagaraʾibaltasbihat |