Gespeichert in:
Beteiligte Personen: | , |
---|---|
Weitere beteiligte Personen: | |
Format: | Buch |
Sprache: | Englisch |
Veröffentlicht: |
London [u.a.]
Bloomsbury
2014
|
Ausgabe: | 1. publ. |
Schriftenreihe: | Drama and performance studies
|
Schlagwörter: | |
Links: | http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=027575254&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |
Beschreibung: | Enth. u.a.: Night watches / by Allan Monkhouse. - Mine eyes have seen / by Alice Dunbar-Nelson |
Umfang: | 470 S. |
ISBN: | 9781472523846 9781472529893 |
Internformat
MARC
LEADER | 00000nam a2200000 c 4500 | ||
---|---|---|---|
001 | BV042135168 | ||
003 | DE-604 | ||
005 | 20150128 | ||
007 | t| | ||
008 | 141020s2014 xx |||| 00||| eng d | ||
020 | |a 9781472523846 |c hbk. |9 978-1-4725-2384-6 | ||
020 | |a 9781472529893 |c pbk. |9 978-1-4725-2989-3 | ||
035 | |a (OCoLC)897796070 | ||
035 | |a (DE-599)BVBBV042135168 | ||
040 | |a DE-604 |b ger |e rakwb | ||
041 | 0 | |a eng | |
049 | |a DE-703 |a DE-11 |a DE-19 |a DE-188 | ||
084 | |a HG 435 |0 (DE-625)49194: |2 rvk | ||
084 | |a HG 620 |0 (DE-625)49218: |2 rvk | ||
084 | |a HG 815 |0 (DE-625)49284: |2 rvk | ||
084 | |a NP 4420 |0 (DE-625)127822: |2 rvk | ||
245 | 1 | 0 | |a First World War plays |b Night watches, Mine eyes have seen, Tunnel trench, Post-mortem, Oh what a lovely war, The Accrington pals, Sea and land and sky |c ed. by Mark Rawlinson |
250 | |a 1. publ. | ||
264 | 1 | |a London [u.a.] |b Bloomsbury |c 2014 | |
300 | |a 470 S. | ||
336 | |b txt |2 rdacontent | ||
337 | |b n |2 rdamedia | ||
338 | |b nc |2 rdacarrier | ||
490 | 0 | |a Drama and performance studies | |
500 | |a Enth. u.a.: Night watches / by Allan Monkhouse. - Mine eyes have seen / by Alice Dunbar-Nelson | ||
650 | 4 | |a Weltkrieg (1914-1918) | |
650 | 4 | |a World War, 1914-1918 / Drama | |
700 | 1 | |a Rawlinson, Mark |d 1970- |0 (DE-588)1065633602 |4 edt | |
700 | 1 | 2 | |a Monkhouse, Allan |4 aut |t Night watches |
700 | 1 | 2 | |a Dunbar-Nelson, Alice Moore |d 1875-1935 |0 (DE-588)123936314 |4 aut |t Mine eyes have seen |
776 | 0 | 8 | |i Erscheint auch als |n Online-Ausgabe, EPUB |z 978-1-4725-2750-9 |
776 | 0 | 8 | |i Erscheint auch als |n Online-Ausgabe, PDF |z 978-1-4725-3262-6 |
856 | 4 | 2 | |m HBZ Datenaustausch |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=027575254&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |3 Inhaltsverzeichnis |
943 | 1 | |a oai:aleph.bib-bvb.de:BVB01-027575254 |
Datensatz im Suchindex
_version_ | 1819268338184880128 |
---|---|
adam_text | Titel: First world war plays
Autor: Rawlinson, Mark
Jahr: 2014
Contents Introduction 6 Night Watches by Allan Monkhouse, 1916 41 Mine Eyes Have Seen by Alice Dunbar-Nelson, 1918 59 Tunnel Trench by Hubert Griffith, 1924 71 Post-Mortem by Noel Coward, 1930 137 Oh What A Lovely War by Theatre Workshop, 1963 215 The Accrington Pals by Peter Whelan, 1981 303 Sea and Land and Sky by Abigail Docherty, 2010 397
|
any_adam_object | 1 |
author | Monkhouse, Allan Dunbar-Nelson, Alice Moore 1875-1935 |
author2 | Rawlinson, Mark 1970- |
author2_role | edt |
author2_variant | m r mr |
author_GND | (DE-588)1065633602 (DE-588)123936314 |
author_facet | Monkhouse, Allan Dunbar-Nelson, Alice Moore 1875-1935 Rawlinson, Mark 1970- |
author_role | aut aut |
author_sort | Monkhouse, Allan |
author_variant | a m am a m d n amd amdn |
building | Verbundindex |
bvnumber | BV042135168 |
classification_rvk | HG 435 HG 620 HG 815 NP 4420 |
ctrlnum | (OCoLC)897796070 (DE-599)BVBBV042135168 |
discipline | Anglistik / Amerikanistik Geschichte |
edition | 1. publ. |
format | Book |
fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>01908nam a2200433 c 4500</leader><controlfield tag="001">BV042135168</controlfield><controlfield tag="003">DE-604</controlfield><controlfield tag="005">20150128 </controlfield><controlfield tag="007">t|</controlfield><controlfield tag="008">141020s2014 xx |||| 00||| eng d</controlfield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9781472523846</subfield><subfield code="c">hbk.</subfield><subfield code="9">978-1-4725-2384-6</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9781472529893</subfield><subfield code="c">pbk.</subfield><subfield code="9">978-1-4725-2989-3</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)897796070</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-599)BVBBV042135168</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-604</subfield><subfield code="b">ger</subfield><subfield code="e">rakwb</subfield></datafield><datafield tag="041" ind1="0" ind2=" "><subfield code="a">eng</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-703</subfield><subfield code="a">DE-11</subfield><subfield code="a">DE-19</subfield><subfield code="a">DE-188</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">HG 435</subfield><subfield code="0">(DE-625)49194:</subfield><subfield code="2">rvk</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">HG 620</subfield><subfield code="0">(DE-625)49218:</subfield><subfield code="2">rvk</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">HG 815</subfield><subfield code="0">(DE-625)49284:</subfield><subfield code="2">rvk</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">NP 4420</subfield><subfield code="0">(DE-625)127822:</subfield><subfield code="2">rvk</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">First World War plays</subfield><subfield code="b">Night watches, Mine eyes have seen, Tunnel trench, Post-mortem, Oh what a lovely war, The Accrington pals, Sea and land and sky</subfield><subfield code="c">ed. by Mark Rawlinson</subfield></datafield><datafield tag="250" ind1=" " ind2=" "><subfield code="a">1. publ.</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">London [u.a.]</subfield><subfield code="b">Bloomsbury</subfield><subfield code="c">2014</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">470 S.</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="b">n</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="b">nc</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="490" ind1="0" ind2=" "><subfield code="a">Drama and performance studies</subfield></datafield><datafield tag="500" ind1=" " ind2=" "><subfield code="a">Enth. u.a.: Night watches / by Allan Monkhouse. - Mine eyes have seen / by Alice Dunbar-Nelson</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Weltkrieg (1914-1918)</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">World War, 1914-1918 / Drama</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Rawlinson, Mark</subfield><subfield code="d">1970-</subfield><subfield code="0">(DE-588)1065633602</subfield><subfield code="4">edt</subfield></datafield><datafield tag="700" ind1="1" ind2="2"><subfield code="a">Monkhouse, Allan</subfield><subfield code="4">aut</subfield><subfield code="t">Night watches</subfield></datafield><datafield tag="700" ind1="1" ind2="2"><subfield code="a">Dunbar-Nelson, Alice Moore</subfield><subfield code="d">1875-1935</subfield><subfield code="0">(DE-588)123936314</subfield><subfield code="4">aut</subfield><subfield code="t">Mine eyes have seen</subfield></datafield><datafield tag="776" ind1="0" ind2="8"><subfield code="i">Erscheint auch als</subfield><subfield code="n">Online-Ausgabe, EPUB</subfield><subfield code="z">978-1-4725-2750-9</subfield></datafield><datafield tag="776" ind1="0" ind2="8"><subfield code="i">Erscheint auch als</subfield><subfield code="n">Online-Ausgabe, PDF</subfield><subfield code="z">978-1-4725-3262-6</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">HBZ Datenaustausch</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=027575254&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Inhaltsverzeichnis</subfield></datafield><datafield tag="943" ind1="1" ind2=" "><subfield code="a">oai:aleph.bib-bvb.de:BVB01-027575254</subfield></datafield></record></collection> |
id | DE-604.BV042135168 |
illustrated | Not Illustrated |
indexdate | 2024-12-20T17:03:08Z |
institution | BVB |
isbn | 9781472523846 9781472529893 |
language | English |
oai_aleph_id | oai:aleph.bib-bvb.de:BVB01-027575254 |
oclc_num | 897796070 |
open_access_boolean | |
owner | DE-703 DE-11 DE-19 DE-BY-UBM DE-188 |
owner_facet | DE-703 DE-11 DE-19 DE-BY-UBM DE-188 |
physical | 470 S. |
publishDate | 2014 |
publishDateSearch | 2014 |
publishDateSort | 2014 |
publisher | Bloomsbury |
record_format | marc |
series2 | Drama and performance studies |
spellingShingle | Monkhouse, Allan Dunbar-Nelson, Alice Moore 1875-1935 First World War plays Night watches, Mine eyes have seen, Tunnel trench, Post-mortem, Oh what a lovely war, The Accrington pals, Sea and land and sky Weltkrieg (1914-1918) World War, 1914-1918 / Drama |
title | First World War plays Night watches, Mine eyes have seen, Tunnel trench, Post-mortem, Oh what a lovely war, The Accrington pals, Sea and land and sky |
title_alt | Night watches Mine eyes have seen |
title_auth | First World War plays Night watches, Mine eyes have seen, Tunnel trench, Post-mortem, Oh what a lovely war, The Accrington pals, Sea and land and sky |
title_exact_search | First World War plays Night watches, Mine eyes have seen, Tunnel trench, Post-mortem, Oh what a lovely war, The Accrington pals, Sea and land and sky |
title_full | First World War plays Night watches, Mine eyes have seen, Tunnel trench, Post-mortem, Oh what a lovely war, The Accrington pals, Sea and land and sky ed. by Mark Rawlinson |
title_fullStr | First World War plays Night watches, Mine eyes have seen, Tunnel trench, Post-mortem, Oh what a lovely war, The Accrington pals, Sea and land and sky ed. by Mark Rawlinson |
title_full_unstemmed | First World War plays Night watches, Mine eyes have seen, Tunnel trench, Post-mortem, Oh what a lovely war, The Accrington pals, Sea and land and sky ed. by Mark Rawlinson |
title_short | First World War plays |
title_sort | first world war plays night watches mine eyes have seen tunnel trench post mortem oh what a lovely war the accrington pals sea and land and sky |
title_sub | Night watches, Mine eyes have seen, Tunnel trench, Post-mortem, Oh what a lovely war, The Accrington pals, Sea and land and sky |
topic | Weltkrieg (1914-1918) World War, 1914-1918 / Drama |
topic_facet | Weltkrieg (1914-1918) World War, 1914-1918 / Drama |
url | http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=027575254&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |
work_keys_str_mv | AT rawlinsonmark firstworldwarplaysnightwatchesmineeyeshaveseentunneltrenchpostmortemohwhatalovelywartheaccringtonpalsseaandlandandsky AT monkhouseallan firstworldwarplaysnightwatchesmineeyeshaveseentunneltrenchpostmortemohwhatalovelywartheaccringtonpalsseaandlandandsky AT dunbarnelsonalicemoore firstworldwarplaysnightwatchesmineeyeshaveseentunneltrenchpostmortemohwhatalovelywartheaccringtonpalsseaandlandandsky |